Call: +7 771 977 66 65, +7 705 421 2277
Sign in or Register
My basket

Astana Biomed Group, an authorized Abcam distributor in Central Asia

Abiomed homepage

  • Categories
    Signal Transduction
    Cancer
    Epigenetics and Nuclear Signaling
    Immunology
    Cell Biology
    Cardiovascular
    Neuroscience
    Tags & Cell Markers
    Kits/ Lysates/ Other
    Developmental Biology
    Microbiology
    Biochemicals
    Secondary antibodies
    Isotype/Loading Controls
    Antibody Arrays
  • About us
  • Partners
  • Contact
    Address

    Saryarka 32, 18, 010000, Astana city, Kazakhstan

    Telephone +7 771 977 66 65, +7 705 421 2277

    Email

    laboratory@ctlab.kz, orders@abiomed.kz

Back to category
Neuroscience Cell Adhesion Proteins Membrane Proteins

Anti-NrCAM antibody [7D8C5] (ab175366)

Anti-NrCAM antibody [7D8C5] (ab175366)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)

Key features and details

  • Mouse monoclonal [7D8C5] to NrCAM
  • Suitable for: WB, ICC/IF
  • Reacts with: Human
  • Isotype: IgG1

You may also be interested in

Product image
Anti-Cadherin 9 antibody [EPR5113] (ab124803)
Product image
Anti-Cathepsin B antibody [CA10] (ab58802)
Product image
Anti-Cathepsin G antibody (ab192793)
Product image
Anti-HNT antibody (ab230351)

Overview

  • Product name

    Anti-NrCAM antibody [7D8C5]
    See all NrCAM primary antibodies
  • Description

    Mouse monoclonal [7D8C5] to NrCAM
  • Host species

    Mouse
  • Tested applications

    Suitable for: WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human NrCAM aa 1192-1255. Expressed in E. coli.
    Sequence:

    RNKGGKYPVKEKEDAHADPEIQPMKEDDGTFGEYSDAEDHKPLKKGSRTP SDRTVKKEDSDDSL


    Database link: Q92823
    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
  • Positive control

    • HepG2 cells; Human NrCAM recombinant protein; NrCAM (aa 1192-1255)-hIgGFc transfected HEK293 cell lysate.
  • General notes

    Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.

    Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.

    We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.

    In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.

    We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.

    Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.

    Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.05% Sodium azide
    Constituent: 99% PBS

    0.5% protein stabilizer
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purified from tissue culture supernatant.
  • Clonality

    Monoclonal
  • Clone number

    7D8C5
  • Isotype

    IgG1
  • Research areas

    • Neuroscience
    • Cell Adhesion Proteins
    • Membrane Proteins
    • Neuroscience
    • Neurology process
    • Neurogenesis

Images

  • Western blot - Anti-NrCAM antibody [7D8C5] (ab175366)
    Western blot - Anti-NrCAM antibody [7D8C5] (ab175366)
    All lanes : Anti-NrCAM antibody [7D8C5] (ab175366) at 1/500 dilution

    Lane 1 : non transfected HEK293 cell lysate.
    Lane 2 : NrCAM (aa 1192-1255)-hIgGFc transfected HEK293 cell lysate.

    Predicted band size: 144 kDa



    Expected MW is 32.7 kDa

  • Western blot - Anti-NrCAM antibody [7D8C5] (ab175366)
    Western blot - Anti-NrCAM antibody [7D8C5] (ab175366)
    Anti-NrCAM antibody [7D8C5] (ab175366) at 1/500 dilution + Human NrCAM recombinant protein

    Predicted band size: 144 kDa



    Expected MW is 32.7 kDa

  • Immunocytochemistry/ Immunofluorescence - Anti-NrCAM antibody [7D8C5] (ab175366)
    Immunocytochemistry/ Immunofluorescence - Anti-NrCAM antibody [7D8C5] (ab175366)

    Immunofluorescent analysis of HepG2 cells labeling NrCAM using ab175366 at 1/50 dilution (green).

    Blue: DRAQ5 fluorescent DNA dye.

    Red: Actin filaments have been labeled with Alexa Fluor-555 phalloidin.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Alternative products to Anti-NrCAM antibody [7D8C5] (ab175366)

  •  
  • Product image

    Anti-NrCAM antibody [EPR15654] (ab191418)

    Applications: IP, WB

  •  
  • Product image

    Anti-NrCAM antibody [S364-51] (ab186247)

    Applications: ICC/IF

  •  
  • Product image

    Anti-NrCAM antibody - Neuronal Marker (ab24344)

    Applications: ICC/IF, WB

Clear all

Recently viewed products

  •  
  • Product image

    Anti-RPF2 antibody [EPR10253(B)] (ab166889)

  •  
  • Product image

    Anti-DcR3 antibody [3C5H10] (ab233816)

  •  
  • Product image

    Human IRAK-1 Matched Antibody Pair Kit (ab220136)

  •  
  • Product image

    Anti-Cellubrevin antibody - N-terminal (ab181749)

  •  
  • Product image

    Anti-Macrophage Inflammatory Protein 3 alpha antibody (ab122889)

  •  
  • Product image

    Anti-Dihydrofolate reductase (DHFR) antibody (ab49881)

Get resources and offers direct to your inbox Sign up
© 2021 Astana Biomed Group LLP. All rights reserved.