Anti-p95/NBS1 antibody [7E4C2] (ab181780)
Key features and details
- Mouse monoclonal [7E4C2] to p95/NBS1
- Suitable for: WB, ICC/IF, Flow Cyt, IHC-P
- Reacts with: Human
- Isotype: IgG2a
Overview
-
Product name
Anti-p95/NBS1 antibody [7E4C2]
See all p95/NBS1 primary antibodies -
Description
Mouse monoclonal [7E4C2] to p95/NBS1 -
Host species
Mouse -
Tested Applications & Species
See all applications and species dataApplication Species Flow Cyt HumanICC/IF HumanIHC-P HumanWB Human -
Immunogen
Recombinant fragment corresponding to Human p95/NBS1 aa 467-615. Expressed in E. Coli.
Sequence:ERDEENQEMSSCKSARIETSCSLLEQTQPATPSLWKNKEQHLSENEPVDT NSDNNLFTDTDLKSIVKNSASKSHAAEKLRSNKKREMDDVAIEDEVLEQL FKDTKPELEIDVKVQKQEEDVNVRKRPRMDIETNDTFSDEAVPESSKIS
Database link: O60934 -
Positive control
- Human p95/NBS1 recombinant protein; HEK293 cell lysate, transfected with p95/NBS1 (amino acids 467-615)-IgGFc; Jurkat cell lysate; HeLa cells; Human cervical cancer and colon cancer tissues.
-
General notes
This product was previously labelled as p95 NBS1
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing the problem with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation.
One factor contributing to the crisis is the use of antibodies that are not suitable. This can lead to misleading results and the use of incorrect data informing project assumptions and direction. To help address this challenge, we have introduced an application and species grid on our primary antibody datasheets to make it easy to simplify identification of the right antibody for your needs.
Learn more here.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
Preservative: 0.05% Sodium azide
Constituent: 99% PBS -
Concentration information loading...
-
Purity
Protein G purified -
Purification notes
Purified from tissue culture supernatant. -
Clonality
Monoclonal -
Clone number
7E4C2 -
Isotype
IgG2a -
Research areas
Images
-
Anti-p95/NBS1 antibody [7E4C2] (ab181780) at 1/500 dilution + Human p95/NBS1 recombinant protein (amino acids 467-615)
Predicted band size: 85 kDa
-
All lanes : Anti-p95/NBS1 antibody [7E4C2] (ab181780) at 1/500 dilution
Lane 1 : HEK293 cell lysate, non-transfected
Lane 2 : HEK293 cell lysate, transfected with p95/NBS1 (amino acids 467-615)-hIgGFc
Predicted band size: 85 kDa
-
Anti-p95/NBS1 antibody [7E4C2] (ab181780) at 1/500 dilution + Jurkat cell lysate
Predicted band size: 85 kDa
-
Immunofluorescent analysis of HeLa cells labeling p95/NBS1 with ab181780 at 1/200 dilution (green). Blue: DRAQ5 fluorescent DNA dye. Red: Actin filaments have been labeled with Alexa Fluor-555 phalloidin.
-
Flow cytometric analysis of HeLa cells labeling p95/NBS1 with ab181780 at 1/200 dilution (green); negative control (red).
-
Immunohistochemical analysis of paraffin-embedded Human cervical cancer tissue labeling p95/NBS1 with ab181780 at 1/200 dilution followed by DAB staining.
-
Immunohistochemical analysis of paraffin-embedded Human colon cancer tissue labeling p95/NBS1 with ab181780 at 1/200 dilution followed by DAB staining.