Anti-p95/NBS1 antibody [7E4A2] (ab181729)
![Anti-p95/NBS1 antibody [7E4A2] (ab181729)](https://www.abcam.com/ps/products/181/ab181729/Images/ab181729-210936-anti-p95-nbs1-antibody-7e4a2-western-blot.jpg "Anti-p95/NBS1 antibody [7E4A2] (ab181729)")
Key features and details
- Mouse monoclonal [7E4A2] to p95/NBS1
- Suitable for: Flow Cyt, IHC-P, WB, ICC/IF
- Reacts with: Rat, Human
- Isotype: IgG2a
Overview
-
Product name
Anti-p95/NBS1 antibody [7E4A2]
See all p95/NBS1 primary antibodies -
Description
Mouse monoclonal [7E4A2] to p95/NBS1 -
Host species
Mouse -
Tested Applications & Species
See all applications and species dataApplication Species Flow Cyt HumanICC/IF HumanIHC-P HumanWB Human
-
Immunogen
Recombinant fragment corresponding to Human p95/NBS1 aa 467-615. Expressed in E. Coli.
Sequence:ERDEENQEMSSCKSARIETSCSLLEQTQPATPSLWKNKEQHLSENEPVDT NSDNNLFTDTDLKSIVKNSASKSHAAEKLRSNKKREMDDVAIEDEVLEQL FKDTKPELEIDVKVQKQEEDVNVRKRPRMDIETNDTFSDEAVPESSKIS
Database link: O60934 -
Positive control
- A549, Jurkat and PC-12 cell lysates; p95/NBS1 (aa 467-615) recombinant protein; p95/NBS1 (aa 467-615)-hIgGFc transfected HEK293 cell lysate; Hela cells; Human cervical cancer and Human rectum cancer tissues.
-
General notes
This product was changed from ascites to supernatant. Lot no’s high than GR150721-8 are from Tissue Culture Supernatant
This product was previously labelled as p95 NBS1
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing the problem with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation.
One factor contributing to the crisis is the use of antibodies that are not suitable. This can lead to misleading results and the use of incorrect data informing project assumptions and direction. To help address this challenge, we have introduced an application and species grid on our primary antibody datasheets to make it easy to simplify identification of the right antibody for your needs.
Learn more here.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
Preservative: 0.05% Sodium azide
Constituent: 99% PBS -
Concentration information loading... -
Purity
Protein G purified -
Purification notes
Purified from tissue culture supernatant. -
Clonality
Monoclonal -
Clone number
7E4A2 -
Isotype
IgG2a -
Research areas
Images
-
Western blot - Anti-p95/NBS1 antibody [7E4A2] (ab181729)All lanes : Anti-p95/NBS1 antibody [7E4A2] (ab181729) at 1/500 dilution
Lane 1 : A549 cell lysate
Lane 2 : Jurkat cell lysate
Lane 3 : PC-12 cell lysate
Predicted band size: 84 kDa
-
![Immunocytochemistry/ Immunofluorescence - Anti-p95/NBS1 antibody [7E4A2] (ab181729)](https://www.abcam.com/ps/products/181/ab181729/Images/ab181729-210939-anti-p95-nbs1-antibody-7e4a2-immunofluorescence.jpg)
Immunocytochemistry/ Immunofluorescence - Anti-p95/NBS1 antibody [7E4A2] (ab181729)Immunofluorescent analysis of HeLa cells labeling p95/NBS1 with ab181729 at 1/200 (green). Blue: DRAQ5 fluorescent DNA dye. Red: Actin filaments have been labeled with Alexa Fluor-555 phalloidin.
-
![Western blot - Anti-p95/NBS1 antibody [7E4A2] (ab181729)](https://www.abcam.com/ps/products/181/ab181729/Images/ab181729-210938-anti-p95-nbs1-antibody-7e4a2-western-blot.jpg)
Western blot - Anti-p95/NBS1 antibody [7E4A2] (ab181729)All lanes : Anti-p95/NBS1 antibody [7E4A2] (ab181729) at 1/500 dilution
Lane 1 : non-transfected HEK293 cell lysate
Lane 2 : p95/NBS1 (aa 467-615)-hIgGFc transfected HEK293 cell lysate
Predicted band size: 84 kDa
-
![Western blot - Anti-p95/NBS1 antibody [7E4A2] (ab181729)](https://www.abcam.com/ps/products/181/ab181729/Images/ab181729-210937-anti-p95-nbs1-antibody-7e4a2-western-blot.jpg)
Western blot - Anti-p95/NBS1 antibody [7E4A2] (ab181729)Anti-p95/NBS1 antibody [7E4A2] (ab181729) at 1/500 dilution + p95/NBS1 (aa 467-615) human recombinant protein
Predicted band size: 84 kDa
-
![Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-p95/NBS1 antibody [7E4A2] (ab181729)](https://www.abcam.com/ps/products/181/ab181729/Images/ab181729-210942-anti-p95-nbs1-antibody-7e4a2-immunohistochemistry.jpg)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-p95/NBS1 antibody [7E4A2] (ab181729)Immunohistochemical analysis of paraffin embedded Human rectum cancer tissue labeling p95/NBS1 with ab181729 at 1/200 with DAB staining.
-
![Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-p95/NBS1 antibody [7E4A2] (ab181729)](https://www.abcam.com/ps/products/181/ab181729/Images/ab181729-210941-anti-p95-nbs1-antibody-7e4a2-immunohistochemistry.jpg)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-p95/NBS1 antibody [7E4A2] (ab181729)Immunohistochemical analysis of paraffin embedded Human cervical cancer tissue labeling p95/NBS1 with ab181729 at 1/200 with DAB staining.
-
![Flow Cytometry - Anti-p95/NBS1 antibody [7E4A2] (ab181729)](https://www.abcam.com/ps/products/181/ab181729/Images/ab181729-210940-anti-p95-nbs1-antibody-7e4a2-flow-cytometry.jpg)
Flow Cytometry - Anti-p95/NBS1 antibody [7E4A2] (ab181729)Flow Cytometrical analysis of HeLa cells labeling p95/NBS1 with ab181729 at 1/200 (green) compared to a negative control antibody (red).
