Anti-Nmnat1/NMNAT antibody [2642C5a] (ab84855)
Key features and details
- Mouse monoclonal [2642C5a] to Nmnat1/NMNAT
- Suitable for: WB
- Reacts with: Recombinant fragment
- Isotype: IgG1
Overview
-
Product name
Anti-Nmnat1/NMNAT antibody [2642C5a]
See all Nmnat1/NMNAT primary antibodies -
Description
Mouse monoclonal [2642C5a] to Nmnat1/NMNAT -
Host species
Mouse -
Tested applications
Suitable for: WBmore details -
Species reactivity
Reacts with: Recombinant fragment -
Immunogen
Recombinant fragment corresponding to Human Nmnat1/NMNAT aa 42-149 (internal sequence).
Sequence:TVVKGIISPVGDAYKKKGLIPAYHRVIMAELATKNSKWVEVDTWESLQKE WKETLKVLRHHQEKLEASDCDHQQNSPTLERPGRKRKWTETQDSSQKKSL EPKTKAVP
-
General notes
This product was previously labelled as Nmnat1
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles. -
Storage buffer
pH: 7.40
Preservative: 0.05% Sodium azide
Constituents: PBS, 1% BSA -
Concentration information loading... -
Purity
Protein G purified -
Purification notes
ab84855 was purified using protein G column chromatography from culture supernatant of hybridoma cultured in a medium containing bovine IgG-depleted (approximately 95%) fetal bovine serum. Filtered through a 0.22 µm membrane. -
Clonality
Monoclonal -
Clone number
2642C5a -
Isotype
IgG1 -
Research areas
Images
-
Anti-Nmnat1/NMNAT antibody [2642C5a] (ab84855) + Immunogen (Recombinant Human Nmnat1/NMNAT fragment)
Predicted band size: 32 kDa
Observed band size: 35 kDa why is the actual band size different from the predicted?

