Anti-Neuropeptide Y antibody
See all Neuropeptide Y primary antibodies

Sheep polyclonal to Neuropeptide Y

Sheep

The specificity of the NPY antiserum was determined by radioimmunoassay. Synthetic peptides, somatostatin-14, leu-enkephalin, met-enkephalin, oxytocin, Arg8-vasopressin, vasoactive intestinal peptide, angiotensin II demonstrated less than 0.005% cross- reactivity and substance P less than 0.02%. Peptide YY and bovine pancreatic polypeptide demonstrated approx. 36% and 0.05% cross- reactivity respectively. Human peptide YY share 65% homology amino acid sequence for human NPY. Synthetic NPY completely abolished radio labelled NPY binding to NPY antibody in RIA and antibody binding to tissue antigen.

Reacts with: Rabbit, Guinea pig, Human

Synthetic peptide:

TPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY

, corresponding to amino acids 30-64 of Human Neuropeptide Y. The peptide was coupled to Bovine Thyroglobulin.

Liquid

Shipped at 4°C. Store at +4°C short term (1-2 weeks). Add glycerol to a final volume of 50% for extra stability and aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

Whole antiserum

Polyclonal

IgG

• Neuroscience
• Neurotransmitter
• Neuropeptides
• Hormones

• Neuroscience
• Neurotransmitter
• Neuropeptides
• More Neuropeptides

• Cardiovascular
• Angiogenesis
• Angiogenic Factors

• Neuroscience
• Neurology process
• Metabolism

• Cardiovascular
• Heart
• Hypertrophy
• Other

• Cardiovascular
• Heart
• Contractility
• Inotropics

• Cardiovascular
• Vasculature
• Vasoconstriction
• Other

• Metabolism
• Types of disease
• Cancer