Call: +7 771 977 66 65, +7 705 421 2277
Sign in or Register
My basket

Astana Biomed Group, an authorized Abcam distributor in Central Asia

Abiomed homepage

  • Categories
    Signal Transduction
    Cancer
    Epigenetics and Nuclear Signaling
    Immunology
    Cell Biology
    Cardiovascular
    Neuroscience
    Tags & Cell Markers
    Kits/ Lysates/ Other
    Developmental Biology
    Microbiology
    Biochemicals
    Secondary antibodies
    Isotype/Loading Controls
    Antibody Arrays
  • About us
  • Partners
  • Contact
    Address

    Saryarka 32, 18, 010000, Astana city, Kazakhstan

    Telephone +7 771 977 66 65, +7 705 421 2277

    Email

    laboratory@ctlab.kz, orders@abiomed.kz

Back to category

Anti-NAPSIN A antibody [10C4B8] (ab175426)

Anti-NAPSIN A antibody [10C4B8] (ab175426)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)

Key features and details

  • Mouse monoclonal [10C4B8] to NAPSIN A
  • Suitable for: IHC-P, WB
  • Reacts with: Rat, Human, Recombinant fragment
  • Isotype: IgG1

You may also be interested in

Product image
PE Anti-RANKL antibody [IK22/5] (ab93553)
Product image
Anti-Strumpellin antibody - C-terminal (ab206687)
Product image
Anti-KIF12 antibody (ab254748)
Product image
Recombinant human GCSF Receptor protein (Fc Chimera) (ab83994)

Overview

  • Product name

    Anti-NAPSIN A antibody [10C4B8]
    See all NAPSIN A primary antibodies
  • Description

    Mouse monoclonal [10C4B8] to NAPSIN A
  • Host species

    Mouse
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Rat, Human, Recombinant fragment
  • Immunogen

    Recombinant fragment corresponding to Human NAPSIN A aa 20-158.
    Sequence:

    EPSGATLIRIPLHRVQPGRRILNLLRGWREPAELPKLGAPSPGDKPIFVP LSNYRDVQYFGEIGLGTPPQNFTVAFDTGSSNLWVPSRRCHFFSVPCWLH HRFDPKASSSFQANGTKFAI QYGTGRVDGILSEDKLTIG


    Database link: O96009
    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
  • Positive control

    • NAPSIN A recombinant protein; NAPSIN A transfected HEK293 cell lysate; Rat liver tissue lysate; Rectum cancer tissues; Liver cancer tissues.
  • General notes

    Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.

    Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.

    We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.

    In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.

    We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.

    Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.

    Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.05% Sodium azide
    Constituent: 99% PBS

    0.5% protein stabilizer
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purified from tissue culture supernatant.
  • Clonality

    Monoclonal
  • Clone number

    10C4B8
  • Isotype

    IgG1
  • Research areas

    • Tags & Cell Markers
    • Cell Type Markers
    • Tumor Associated
    • Cell Biology
    • Proteolysis / Ubiquitin
    • Proteolytic enzymes
    • Other proteases

Images

  • Western blot - Anti-NAPSIN A antibody [10C4B8] (ab175426)
    Western blot - Anti-NAPSIN A antibody [10C4B8] (ab175426)
    All lanes : Anti-NAPSIN A antibody [10C4B8] (ab175426) at 1/500 dilution

    Lane 1 : HEK293 cell lysate
    Lane 2 : NAPSIN A (AA: 20-158)-hIgGFc transfected HEK293 cell lysate

    Predicted band size: 45 kDa

  • Western blot - Anti-NAPSIN A antibody [10C4B8] (ab175426)
    Western blot - Anti-NAPSIN A antibody [10C4B8] (ab175426)
    Anti-NAPSIN A antibody [10C4B8] (ab175426) at 1/500 dilution + NAPSIN recombinant protein

    Predicted band size: 45 kDa

  • Western blot - Anti-NAPSIN A antibody [10C4B8] (ab175426)
    Western blot - Anti-NAPSIN A antibody [10C4B8] (ab175426)
    Anti-NAPSIN A antibody [10C4B8] (ab175426) at 1/500 dilution + Rat liver tissue lysate

    Predicted band size: 45 kDa

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-NAPSIN A antibody [10C4B8] (ab175426)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-NAPSIN A antibody [10C4B8] (ab175426)

    Immunohistochemical analysis of paraffin-embedded liver cancer tissues labeling NAPSIN A with ab175426 at 1/200 dilution with DAB staining.

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-NAPSIN A antibody [10C4B8] (ab175426)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-NAPSIN A antibody [10C4B8] (ab175426)

    Immunohistochemical analysis of paraffin-embedded rectum cancer tissues labeling NAPSIN A with ab175426 at 1/200 dilution, with DAB staining.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Alternative products to Anti-NAPSIN A antibody [10C4B8] (ab175426)

  •  
  • Product image

    Anti-NAPSIN A antibody [EPR6257] (ab129189)

    Applications: IHC-P, WB

  •  
  • Product image

    Anti-NAPSIN A antibody [EPR6252] (ab133249)

    Applications: IHC-P, IP, WB

  •  
  • Product image

    Anti-NAPSIN A antibody [KCG1.1] (ab73021)

    Applications: Flow Cyt, IHC-P

  •  
  • Product image

    Anti-NAPSIN A antibody [EPR10713(B)] (ab166619)

    Applications: ICC/IF, WB

  •  
  • Product image

    Anti-NAPSIN A antibody (ab187300)

    Applications: IHC-P

  •  
  • Product image

    Anti-NAPSIN A antibody [NAPSA/1238] - BSA and Azide free (ab213060)

    Applications: IHC-P, Protein Array, WB

Clear all

Recently viewed products

  •  
  • Product image

    Anti-ALS2CR7 antibody [OTI4H2] (ab279393)

  •  
  • Anti-Calponin 1 antibody [CALP] (ab700)

  •  
  • Product image

    Anti-Citrate synthetase antibody (ab151607)

  •  
  • Product image

    FITC Anti-CD59 antibody [MEM-43], prediluted (ab18237)

  •  
  • Product image

    HRP Anti-HA tag antibody (ab183884)

  •  
  • Recombinant human VEGFA protein (Animal Free) (ab217394)

Get resources and offers direct to your inbox Sign up
© 2021 Astana Biomed Group LLP. All rights reserved.