Anti-H-protein antibody [OTI3G1] (ab156763)
Key features and details
- Mouse monoclonal [OTI3G1] to H-protein
- Suitable for: WB, IHC-P, ICC/IF
- Reacts with: Human, African green monkey
- Isotype: IgG2a
Overview
-
Product name
Anti-H-protein antibody [OTI3G1] -
Description
Mouse monoclonal [OTI3G1] to H-protein -
Host species
Mouse -
Tested applications
Suitable for: WB, IHC-P, ICC/IFmore details -
Species reactivity
Reacts with: Human, African green monkey -
Immunogen
Recombinant full length protein corresponding to Human H-protein aa 1-477. H-protein (NP_004988) produced in HEK-293T cell.
Sequence:MMEKNTSEGPACSPEETASESAKVPTAEPPGEVAVSESTREEQVPKPQAP APQAPTASTATKPAPPSEDVPSAPLLLTLDDVSSSSVTVSWEPPERLGRL GLQGYVLELCREGASEWVPVSARPMMVTQQTVRNLALGDKFLLRVSAVSS AGAGPPAMLDQPIHIRENIEAPKIRVPRHLRQTYIRQVGETVNLQIPFQG KPKPQATWTHNGHALDSQRVSMRTGDQDSILFIRSAQRSDSGRYELTVRV EDLEAKAVIDILVIEKPGPPSSIRLLDVWGCNAALQWTPPQDTGNTELLG YMVQKADKKTGQWFTVLERYHPTTCTISDLIIGNSYSFRVFSENLCGLST SATVTKELAHIQKADIAAKPKGFIERDFSEAPSFTQPLADHTSTPGYSTQ LFCSVRASPKPKIIWMKNKMEIQGNPKYRALSEQGVCTLEIRKPSPFDSG VYTCKAINVLGEASVDCRLEVKASAAH
Database link: Q13203 -
Positive control
- Human colon adenocarcinoma tissue, Human lung carcinoma tissue and Human pancreas tissue. HeLa cells.
-
General notes
The clone number has been updated from 3G1 to OTI3G1, both clone numbers name the same clone.
Previously labelled as MYBPH.
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing the problem with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation.
One factor contributing to the crisis is the use of antibodies that are not suitable. This can lead to misleading results and the use of incorrect data informing project assumptions and direction. To help address this challenge, we have introduced an application and species grid on our primary antibody datasheets to make it easy to simplify identification of the right antibody for your needs.
Learn more here.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.30
Preservative: 0.02% Sodium azide
Constituents: PBS, 50% Glycerol, 1% BSA -
Concentration information loading...
-
Purity
Protein A purified -
Clonality
Monoclonal -
Clone number
OTI3G1 -
Isotype
IgG2a -
Research areas
Images
-
All lanes : Anti-H-protein antibody [OTI3G1] (ab156763) at 1/4000 dilution
Lane 1 : HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) cell lysate transfected with pCMV6-ENTRY control
Lane 2 : HEK-293T cells transfected with pCMV6-ENTRY H-protein
Lysates/proteins at 5 µg per lane.
Predicted band size: 52 kDa
-
Immunofluorescence analysis of COS7 cells transiently transfected by pCMV6-ENTRY H-protein labeling H-protein with ab156763 at 1/100.
-
Paraffin embedded Human colon adenocarcinoma tissue labeling H-protein with ab156763 at 1/150 in immunohistochemical analysis.
-
Paraffin embedded Human lung carcinoma tissue labeling H-protein with ab156763 at 1/150 in immunohistochemical analysis.
-
Paraffin embedded Human pancreas tissue labeling H-protein with ab156763 at 1/150 in immunohistochemical analysis.