Anti-GST antibody (ab181652)
Key features and details
- Goat polyclonal to GST
- Suitable for: WB
- Isotype: IgG
Overview
-
Product name
Anti-GST antibody
See all GST primary antibodies -
Description
Goat polyclonal to GST -
Host species
Goat -
Tested applications
Suitable for: WBmore details -
Species reactivity
Reacts with: Other species -
Immunogen
Full length protein corresponding to Schistosoma japonicum GST aa 2-218.
Sequence:SPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLE FPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLD IRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHP DFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAW PLQGWQATFGGGDHPPK
Database link: P08515 -
Positive control
- Recombinant Human GST protein (ab81793) can be used as a positive control in WB. Glutathione-S-Transferase [Schistosoma japonicum]
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
Preservative: 0.01% Sodium azide
Constituents: 0.27% Potassium phosphate, 0.88% Sodium chloride -
Concentration information loading... -
Purity
IgG fraction -
Purification notes
ab181652 is an IgG fraction antibody purified from monospecific antiserum by a multi-step process which includes delipidation, salt fractionation and ion exchange chromatography followed by extensive dialysis. -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Images
-
Western blot - Anti-GST antibody (ab181652)Lanes 1-4 : Anti-GST antibody (ab181652) at 1/5000 dilution
Lane 5 : Anti-GST antibody (ab181652) at 1/1000 dilution (Reduced)
Lane 6 : Anti-GST antibody (ab181652) at 1/1000 dilution (Non-reduced)
Lanes 1 & 3 & 5-6 : Purified GST at 1 µg
Lanes 2 & 4 : Purified GST at 0.25 µgab181652 was used to detect GST under reducing and non-reducing conditions. Reduced samples of purified GST contained 4% BME and were boiled for 5 minutes. For lanes 1-4, samples of ~1 and 0.25 ug of protein per lane were run by SDS-PAGE. Protein was transferred to nitrocellulose and probed with a Goat anti GST at 1/5000 dilution overnight at 4°C. Primary antibody was detected with a conjugated Donkey anti Goat at 1/10000, incubated for 1.5 hr at RT and imaged on the BioRad VersaDoc imaging system. Lanes 5-6 show a repeat western blot with the same samples (~1 ug per lane, reduced (R) and nonreduced (NR) detected with a Dylight 549 conjugated Donkey anti goat incubated at 1/10000 at 1.5 hours at RT.
