Call: +7 771 977 66 65, +7 705 421 2277
Sign in or Register
My basket

Astana Biomed Group, an authorized Abcam distributor in Central Asia

Abiomed homepage

  • Categories
    Signal Transduction
    Cancer
    Epigenetics and Nuclear Signaling
    Immunology
    Cell Biology
    Cardiovascular
    Neuroscience
    Tags & Cell Markers
    Kits/ Lysates/ Other
    Developmental Biology
    Microbiology
    Biochemicals
    Secondary antibodies
    Isotype/Loading Controls
    Antibody Arrays
  • About us
  • Partners
  • Contact
    Address

    Saryarka 32, 18, 010000, Astana city, Kazakhstan

    Telephone +7 771 977 66 65, +7 705 421 2277

    Email

    laboratory@ctlab.kz, orders@abiomed.kz

Back to category
Signal Transduction Protein Trafficking Vesicle Transport Regulation

Anti-GBAS antibody [OTI1B8] (ab139357)

Anti-GBAS antibody [OTI1B8] (ab139357)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)

Key features and details

  • Mouse monoclonal [OTI1B8] to GBAS
  • Suitable for: WB, IHC-P, ICC/IF
  • Reacts with: Mouse, Rat, Dog, Human, African green monkey
  • Isotype: IgG1

You may also be interested in

Product image
Anti-SEC23IP antibody (ab70339)
Product image
Anti-ARF6 antibody [EPR8357] (ab131261)
Product image
Human POLDIP3 (p46) knockout HeLa cell line (ab265843)
Product image
Recombinant Human ENPP5 protein (His tag) (ab276401)

Overview

  • Product name

    Anti-GBAS antibody [OTI1B8]
    See all GBAS primary antibodies
  • Description

    Mouse monoclonal [OTI1B8] to GBAS
  • Host species

    Mouse
  • Tested Applications & Species

    Application Species
    ICC/IF
    Human
    African green monkey
    IHC-P
    Human
    WB
    Human
    See all applications and species data
  • Immunogen

    Recombinant full length protein corresponding to Human GBAS aa 1-286. Produced in E.coli (NP_001474).
    Sequence:

    MAARVLRARGAAWAGGLLQRAAPCSLLPRLRTWTSSSNRSREDSWLKSLF VRKVDPRKDAHSNLLAKKETSNLYKLQFHNVKPECLEAYNKICQEVLPKI HEDKHYPCTLVGTWNTWYGEQDQAVHLWRYEGGYPALTEVMNKLRENKEF LEFRKARSDMLLSRKNQLLLEFSFWNEPVPRSGPNIYELRSYQLRPGTMI EWGNYWARAIRFRQDGNEAVGGFFSQIGQLYMVHHLWAYRDLQTREDIRN AAWHKHGWEELVYYTVPLIQEMESRIMIPLKTSPLQ


    Database link: O75323
    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
  • Positive control

    • WB: HEK-293T cell lysate transfected with pCMV6-ENTRY GBAS cDNA; HepG2, HeLa, SVT2, A549, COS7, Jurkat, MDCK, PC12 and MCF7 cell extracts; Human testis uterus, breast, brain, liver, ovary, thyroid gland and colon extracts. IHC-P: Human colon adenocarcinoma, kidney, ovary adenocarcinoma and endometrium adenocarcinoma tissues. ICC/IF: COS-7 cells transiently transfected with pCMV6-ENTRY GBAS; HeLa cells.
  • General notes

    Clone OTI1B8 (formerly 1B8).

    The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing the problem with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation.

    One factor contributing to the crisis is the use of antibodies that are not suitable. This can lead to misleading results and the use of incorrect data informing project assumptions and direction. To help address this challenge, we have introduced an application and species grid on our primary antibody datasheets to make it easy to simplify identification of the right antibody for your needs.

    Learn more here.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.30
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 1% BSA, 50% Glycerol
  • Concentration information loading...
  • Purity

    Affinity purified
  • Purification notes

    Purified from cell culture supernatant by affinity chromatography.
  • Clonality

    Monoclonal
  • Clone number

    OTI1B8
  • Isotype

    IgG1
  • Research areas

    • Signal Transduction
    • Protein Trafficking
    • Vesicle Transport
    • Regulation

Images

  • Western blot - Anti-GBAS antibody [OTI1B8] (ab139357)
    Western blot - Anti-GBAS antibody [OTI1B8] (ab139357)
    All lanes : Anti-GBAS antibody [OTI1B8] (ab139357) at 1/200 dilution

    Lane 1 : Human testis extract
    Lane 2 : Human uterus extract
    Lane 3 : Human breast extract
    Lane 4 : Human brain extract
    Lane 5 : Human liver extract
    Lane 6 : Human ovary extract
    Lane 7 : Human thyroid gland extract
    Lane 8 : Human colon extract

    Lysates/proteins at 10 µg per lane.

    Predicted band size: 34 kDa

  • Immunocytochemistry/ Immunofluorescence - Anti-GBAS antibody [OTI1B8] (ab139357)
    Immunocytochemistry/ Immunofluorescence - Anti-GBAS antibody [OTI1B8] (ab139357)

    HeLa (human epithelial cell line from cervix adenocarcinoma) cells stained for GBAS (green) using ab139357 at 1/100 dilution in ICC/IF.

  • Western blot - Anti-GBAS antibody [OTI1B8] (ab139357)
    Western blot - Anti-GBAS antibody [OTI1B8] (ab139357)
    All lanes : Anti-GBAS antibody [OTI1B8] (ab139357) at 1/200 dilution

    Lane 1 : HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) cell lysate transfected with the pCMV6-ENTRY control cDNA
    Lane 2 : HEK-293T cell lysate transfected with pCMV6-ENTRY GBAS cDNA

    Lysates/proteins at 5 µg per lane.

    Predicted band size: 34 kDa

  • Western blot - Anti-GBAS antibody [OTI1B8] (ab139357)
    Western blot - Anti-GBAS antibody [OTI1B8] (ab139357)
    All lanes : Anti-GBAS antibody [OTI1B8] (ab139357) at 1/200 dilution

    Lane 1 : HepG2 (human liver hepatocellular carcinoma cell line) cell extract
    Lane 2 : HeLa (human epithelial cell line from cervix adenocarcinoma) cell extract
    Lane 3 : SVT2 cell extract
    Lane 4 : A549 (human lung carcinoma cell line) cell extract
    Lane 5 : COS7 (african green monkey kidney fibroblast-like cell line) cell extract
    Lane 6 : Jurkat (human T cell leukemia cell line from peripheral blood) cell extract
    Lane 7 : MDCK (canine kidney cell line) cell extract
    Lane 8 : PC-12 (rat adrenal gland pheochromocytoma cell line) cell extract
    Lane 9 : MCF7 (human breast adenocarcinoma cell line) cell extract

    Lysates/proteins at 35 µg per lane.

    Predicted band size: 34 kDa

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-GBAS antibody [OTI1B8] (ab139357)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-GBAS antibody [OTI1B8] (ab139357)

    Paraffin-embedded human colon adenocarcinoma tissue stained for GBAS using ab139357 at 1/150 dilution in immunohistochemical analysis.

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-GBAS antibody [OTI1B8] (ab139357)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-GBAS antibody [OTI1B8] (ab139357)

    Paraffin-embedded human kidney tissue stained for GBAS using ab139357 at 1/150 dilution in immunohistochemical analysis.

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-GBAS antibody [OTI1B8] (ab139357)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-GBAS antibody [OTI1B8] (ab139357)

    Paraffin-embedded human ovary adenocarcinoma tissue stained for GBAS using ab139357 at 1/150 dilution in immunohistochemical analysis.

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-GBAS antibody [OTI1B8] (ab139357)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-GBAS antibody [OTI1B8] (ab139357)

    Paraffin-embedded human endometrium adenocarcinoma tissue stained for GBAS using ab139357 at 1/150 dilution in immunohistochemical analysis.

  • Immunocytochemistry/ Immunofluorescence - Anti-GBAS antibody [OTI1B8] (ab139357)
    Immunocytochemistry/ Immunofluorescence - Anti-GBAS antibody [OTI1B8] (ab139357)

    COS-7 (african green monkey kidney fibroblast-like cell line) cells transiently transfected by pCMV6-ENTRY GBAS stained for GBAS (green) using ab139357 at 1/50 dilution in ICC/IF.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Alternative products to Anti-GBAS antibody [OTI1B8] (ab139357)

  •  
  • Product image

    Anti-GBAS antibody (ab227967)

    Applications: WB

  •  
  • Product image

    Anti-GBAS antibody [1B8] (ab230672)

    Applications: ICC/IF, IHC-P, WB

  •  
  • Product image

    Anti-GBAS antibody (ab204890)

    Applications: ICC/IF, IHC-P, WB

  •  
  • Product image

    Anti-GBAS antibody (ab227951)

    Applications: IHC-P, WB

  •  
  • Product image

    Anti-GBAS antibody (ab83845)

    Applications: IHC-P, WB

  •  
  • Product image

    Anti-GBAS antibody (ab153833)

    Applications: IHC-P, WB

  •  
  • Product image

    Anti-GBAS antibody (ab227961)

    Applications: ICC/IF, WB

Clear all

Recently viewed products

  •  
  • Product image

    Anti-Hes1 antibody [2D2] (ab119776)

  •  
  • Product image

    Anti-alpha + beta Synuclein antibody [EP1646Y] (ab51252)

  •  
  • Product image

    Anti-ID2 antibody [OTI10C3] (ab90055)

  •  
  • Product image

    Anti-LMO2 antibody [EP3257] (ab91652)

  •  
  • Product image

    Anti-AHA1 antibody [25F2.D9] (ab91259)

  •  
  • Product image

    Anti-PSD93 antibody [N18/30] (ab94588)

Get resources and offers direct to your inbox Sign up
© 2021 Astana Biomed Group LLP. All rights reserved.