Anti-GBAS antibody [OTI1B8] (ab139357)
Key features and details
- Mouse monoclonal [OTI1B8] to GBAS
- Suitable for: WB, IHC-P, ICC/IF
- Reacts with: Mouse, Rat, Dog, Human, African green monkey
- Isotype: IgG1
Overview
-
Product name
Anti-GBAS antibody [OTI1B8]
See all GBAS primary antibodies -
Description
Mouse monoclonal [OTI1B8] to GBAS -
Host species
Mouse -
Tested Applications & Species
See all applications and species dataApplication Species ICC/IF HumanAfrican green monkeyIHC-P HumanWB Human -
Immunogen
Recombinant full length protein corresponding to Human GBAS aa 1-286. Produced in E.coli (NP_001474).
Sequence:MAARVLRARGAAWAGGLLQRAAPCSLLPRLRTWTSSSNRSREDSWLKSLF VRKVDPRKDAHSNLLAKKETSNLYKLQFHNVKPECLEAYNKICQEVLPKI HEDKHYPCTLVGTWNTWYGEQDQAVHLWRYEGGYPALTEVMNKLRENKEF LEFRKARSDMLLSRKNQLLLEFSFWNEPVPRSGPNIYELRSYQLRPGTMI EWGNYWARAIRFRQDGNEAVGGFFSQIGQLYMVHHLWAYRDLQTREDIRN AAWHKHGWEELVYYTVPLIQEMESRIMIPLKTSPLQ
Database link: O75323 -
Positive control
- WB: HEK-293T cell lysate transfected with pCMV6-ENTRY GBAS cDNA; HepG2, HeLa, SVT2, A549, COS7, Jurkat, MDCK, PC12 and MCF7 cell extracts; Human testis uterus, breast, brain, liver, ovary, thyroid gland and colon extracts. IHC-P: Human colon adenocarcinoma, kidney, ovary adenocarcinoma and endometrium adenocarcinoma tissues. ICC/IF: COS-7 cells transiently transfected with pCMV6-ENTRY GBAS; HeLa cells.
-
General notes
Clone OTI1B8 (formerly 1B8).
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing the problem with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation.
One factor contributing to the crisis is the use of antibodies that are not suitable. This can lead to misleading results and the use of incorrect data informing project assumptions and direction. To help address this challenge, we have introduced an application and species grid on our primary antibody datasheets to make it easy to simplify identification of the right antibody for your needs.
Learn more here.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.30
Preservative: 0.02% Sodium azide
Constituents: PBS, 1% BSA, 50% Glycerol -
Concentration information loading...
-
Purity
Affinity purified -
Purification notes
Purified from cell culture supernatant by affinity chromatography. -
Clonality
Monoclonal -
Clone number
OTI1B8 -
Isotype
IgG1 -
Research areas
Images
-
All lanes : Anti-GBAS antibody [OTI1B8] (ab139357) at 1/200 dilution
Lane 1 : Human testis extract
Lane 2 : Human uterus extract
Lane 3 : Human breast extract
Lane 4 : Human brain extract
Lane 5 : Human liver extract
Lane 6 : Human ovary extract
Lane 7 : Human thyroid gland extract
Lane 8 : Human colon extract
Lysates/proteins at 10 µg per lane.
Predicted band size: 34 kDa
-
HeLa (human epithelial cell line from cervix adenocarcinoma) cells stained for GBAS (green) using ab139357 at 1/100 dilution in ICC/IF.
-
All lanes : Anti-GBAS antibody [OTI1B8] (ab139357) at 1/200 dilution
Lane 1 : HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) cell lysate transfected with the pCMV6-ENTRY control cDNA
Lane 2 : HEK-293T cell lysate transfected with pCMV6-ENTRY GBAS cDNA
Lysates/proteins at 5 µg per lane.
Predicted band size: 34 kDa
-
All lanes : Anti-GBAS antibody [OTI1B8] (ab139357) at 1/200 dilution
Lane 1 : HepG2 (human liver hepatocellular carcinoma cell line) cell extract
Lane 2 : HeLa (human epithelial cell line from cervix adenocarcinoma) cell extract
Lane 3 : SVT2 cell extract
Lane 4 : A549 (human lung carcinoma cell line) cell extract
Lane 5 : COS7 (african green monkey kidney fibroblast-like cell line) cell extract
Lane 6 : Jurkat (human T cell leukemia cell line from peripheral blood) cell extract
Lane 7 : MDCK (canine kidney cell line) cell extract
Lane 8 : PC-12 (rat adrenal gland pheochromocytoma cell line) cell extract
Lane 9 : MCF7 (human breast adenocarcinoma cell line) cell extract
Lysates/proteins at 35 µg per lane.
Predicted band size: 34 kDa
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-GBAS antibody [OTI1B8] (ab139357)
Paraffin-embedded human colon adenocarcinoma tissue stained for GBAS using ab139357 at 1/150 dilution in immunohistochemical analysis.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-GBAS antibody [OTI1B8] (ab139357)
Paraffin-embedded human kidney tissue stained for GBAS using ab139357 at 1/150 dilution in immunohistochemical analysis.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-GBAS antibody [OTI1B8] (ab139357)
Paraffin-embedded human ovary adenocarcinoma tissue stained for GBAS using ab139357 at 1/150 dilution in immunohistochemical analysis.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-GBAS antibody [OTI1B8] (ab139357)
Paraffin-embedded human endometrium adenocarcinoma tissue stained for GBAS using ab139357 at 1/150 dilution in immunohistochemical analysis.
-
COS-7 (african green monkey kidney fibroblast-like cell line) cells transiently transfected by pCMV6-ENTRY GBAS stained for GBAS (green) using ab139357 at 1/50 dilution in ICC/IF.