Antibodies, Proteins, Kits and Reagents for Life Science

Key features and details

Mouse monoclonal [OTI1B8] to GBAS
Suitable for: WB, IHC-P, ICC/IF
Reacts with: Mouse, Rat, Dog, Human, African green monkey
Isotype: IgG1

Product name

Anti-GBAS antibody [OTI1B8]
See all GBAS primary antibodies
Description

Mouse monoclonal [OTI1B8] to GBAS
Host species

Mouse

Tested Applications & Species

Application	Species
ICC/IF	Human African green monkey
IHC-P	Human
WB	Human

See all applications and species data

Immunogen

Recombinant full length protein corresponding to Human GBAS aa 1-286. Produced in E.coli (NP_001474).
Sequence:
MAARVLRARGAAWAGGLLQRAAPCSLLPRLRTWTSSSNRSREDSWLKSLF VRKVDPRKDAHSNLLAKKETSNLYKLQFHNVKPECLEAYNKICQEVLPKI HEDKHYPCTLVGTWNTWYGEQDQAVHLWRYEGGYPALTEVMNKLRENKEF LEFRKARSDMLLSRKNQLLLEFSFWNEPVPRSGPNIYELRSYQLRPGTMI EWGNYWARAIRFRQDGNEAVGGFFSQIGQLYMVHHLWAYRDLQTREDIRN AAWHKHGWEELVYYTVPLIQEMESRIMIPLKTSPLQ

Database link: O75323
Run BLAST with Run BLAST with
Positive control
- WB: HEK-293T cell lysate transfected with pCMV6-ENTRY GBAS cDNA; HepG2, HeLa, SVT2, A549, COS7, Jurkat, MDCK, PC12 and MCF7 cell extracts; Human testis uterus, breast, brain, liver, ovary, thyroid gland and colon extracts. IHC-P: Human colon adenocarcinoma, kidney, ovary adenocarcinoma and endometrium adenocarcinoma tissues. ICC/IF: COS-7 cells transiently transfected with pCMV6-ENTRY GBAS; HeLa cells.
General notes

Clone OTI1B8 (formerly 1B8).
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing the problem with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation.

One factor contributing to the crisis is the use of antibodies that are not suitable. This can lead to misleading results and the use of incorrect data informing project assumptions and direction. To help address this challenge, we have introduced an application and species grid on our primary antibody datasheets to make it easy to simplify identification of the right antibody for your needs.

Learn more here.

Form

Liquid
Storage instructions

Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C. Avoid freeze / thaw cycle.
Storage buffer

pH: 7.30
Preservative: 0.02% Sodium azide
Constituents: PBS, 1% BSA, 50% Glycerol
Concentration information loading...
Purity

Affinity purified
Purification notes

Purified from cell culture supernatant by affinity chromatography.
Clonality

Monoclonal
Clone number

OTI1B8
Isotype

IgG1
Research areas

Western blot - Anti-GBAS antibody [OTI1B8] (ab139357)

All lanes : Anti-GBAS antibody [OTI1B8] (ab139357) at 1/200 dilution

Lane 1 : Human testis extract
Lane 2 : Human uterus extract
Lane 3 : Human breast extract
Lane 4 : Human brain extract
Lane 5 : Human liver extract
Lane 6 : Human ovary extract
Lane 7 : Human thyroid gland extract
Lane 8 : Human colon extract

Lysates/proteins at 10 µg per lane.

Predicted band size: 34 kDa
Immunocytochemistry/ Immunofluorescence - Anti-GBAS antibody [OTI1B8] (ab139357)

HeLa (human epithelial cell line from cervix adenocarcinoma) cells stained for GBAS (green) using ab139357 at 1/100 dilution in ICC/IF.
Western blot - Anti-GBAS antibody [OTI1B8] (ab139357)

All lanes : Anti-GBAS antibody [OTI1B8] (ab139357) at 1/200 dilution

Lane 1 : HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) cell lysate transfected with the pCMV6-ENTRY control cDNA
Lane 2 : HEK-293T cell lysate transfected with pCMV6-ENTRY GBAS cDNA

Lysates/proteins at 5 µg per lane.

Predicted band size: 34 kDa
Western blot - Anti-GBAS antibody [OTI1B8] (ab139357)

All lanes : Anti-GBAS antibody [OTI1B8] (ab139357) at 1/200 dilution

Lane 1 : HepG2 (human liver hepatocellular carcinoma cell line) cell extract
Lane 2 : HeLa (human epithelial cell line from cervix adenocarcinoma) cell extract
Lane 3 : SVT2 cell extract
Lane 4 : A549 (human lung carcinoma cell line) cell extract
Lane 5 : COS7 (african green monkey kidney fibroblast-like cell line) cell extract
Lane 6 : Jurkat (human T cell leukemia cell line from peripheral blood) cell extract
Lane 7 : MDCK (canine kidney cell line) cell extract
Lane 8 : PC-12 (rat adrenal gland pheochromocytoma cell line) cell extract
Lane 9 : MCF7 (human breast adenocarcinoma cell line) cell extract

Lysates/proteins at 35 µg per lane.

Predicted band size: 34 kDa
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-GBAS antibody [OTI1B8] (ab139357)

Paraffin-embedded human colon adenocarcinoma tissue stained for GBAS using ab139357 at 1/150 dilution in immunohistochemical analysis.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-GBAS antibody [OTI1B8] (ab139357)

Paraffin-embedded human kidney tissue stained for GBAS using ab139357 at 1/150 dilution in immunohistochemical analysis.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-GBAS antibody [OTI1B8] (ab139357)

Paraffin-embedded human ovary adenocarcinoma tissue stained for GBAS using ab139357 at 1/150 dilution in immunohistochemical analysis.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-GBAS antibody [OTI1B8] (ab139357)

Paraffin-embedded human endometrium adenocarcinoma tissue stained for GBAS using ab139357 at 1/150 dilution in immunohistochemical analysis.
Immunocytochemistry/ Immunofluorescence - Anti-GBAS antibody [OTI1B8] (ab139357)

COS-7 (african green monkey kidney fibroblast-like cell line) cells transiently transfected by pCMV6-ENTRY GBAS stained for GBAS (green) using ab139357 at 1/50 dilution in ICC/IF.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com