Anti-ID2 antibody [OTI10C3] (ab90055)
Key features and details
- Mouse monoclonal [OTI10C3] to ID2
- Suitable for: WB, IHC-P, ICC/IF, Flow Cyt
- Reacts with: Human
- Isotype: IgG2b
Overview
-
Product name
Anti-ID2 antibody [OTI10C3]
See all ID2 primary antibodies -
Description
Mouse monoclonal [OTI10C3] to ID2 -
Host species
Mouse -
Tested Applications & Species
See all applications and species dataApplication Species Flow Cyt HumanICC/IF HumanIHC-P HumanWB Human -
Immunogen
Recombinant full length protein corresponding to Human ID2 aa 1-134. Protein expressed in E.coli. NP_002157
Sequence:MKAFSPVRSVRKNSLSDHSLGISRSKTPVDDPMSLLYNMNDCYSKLKELV PSIPQNKKVSKMEILQHVIDYILDLQIALDSHPTIVSLHHQRPGQNQASR TPLTTLNTDISILSLQASEFPSELMSNDSKALCG
Database link: Q02363 -
Positive control
- IHC-P: Human liver, bladder carcinoma and liver carcinoma tissue. ICC/IF: HeLa cells. WB: pCMV6-ENTRY ID2 cDNA transfected HEK-293T cell lysate. Flow Cyt: SH-SY5Y cells.
-
General notes
The clone number has been updated from 10C3 to OTI10C3, both clone numbers name the same clone.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.30
Preservative: 0.02% Sodium azide
Constituents: 50% Glycerol, 1% BSA, PBS -
Concentration information loading...
-
Purity
Affinity purified -
Purification notes
Purified from cell culture supernatant by affinity chromatography -
Clonality
Monoclonal -
Clone number
OTI10C3 -
Isotype
IgG2b -
Research areas
Images
-
All lanes : Anti-ID2 antibody [OTI10C3] (ab90055) at 1/500 dilution
Lane 1 : HEK-293T (Human epithelial cell line from embryonic kidney transformed with large T antigen) cells were transfected with the pCMV6-ENTRY control
Lane 2 : HEK-293T cells were transfected with the pCMV6-ENTRY ID2 cDNA
Lysates/proteins at 5 µg per lane.
Predicted band size: 15 kDa
-
Paraffin-embedded human bladder carcinoma tissue stained for ID2 with ab90055 at a 1/50 dilution in immunohistochemical analysis. Heat-induced epitope retrieval by 10 mM citric buffer, pH 6.0, 100°C for 10 minutes.
-
HeLa (Human epithelial cell line from cervix adenocarcinoma) cells stained for ID2 using ab90055 at a 1/50 dilution in ICC/IF.
-
Paraffin-embedded human liver tissue stained for ID2 with ab90055 at a 1/50 dilution in immunohistochemical analysis. Heat-induced epitope retrieval by 10 mM citric buffer, pH 6.0, 100°C for 10 minutes.
-
Paraffin-embedded human liver carcinoma tissue stained for ID2 with ab90055 at a 1/50 dilution in immunohistochemical analysis. Heat-induced epitope retrieval by 10 mM citric buffer, pH 6.0, 100°C for 10 minutes.
-
Overlay histogram showing SH-SY5Y cells stained with ab90055 (red line). The cells were fixed with 4% paraformaldehyde (10 min) and then permeabilized with 0.1% PBS-Tween for 20 min. The cells were then incubated in 1x PBS / 10% normal goat serum / 0.3M glycine to block non-specific protein-protein interactions. The cells were then incubated with the antibody (ab90055, 1µg/1x106 cells) for 30 min at 22ºC. The secondary antibody used was DyLight® 488 goat anti-mouse IgG (H+L) (ab96879) at 1/500 dilution for 30 min at 22ºC. Isotype control antibody (black line) was mouse IgG2b [PLPV219] (ab91366, 2µg/1x106 cells) used under the same conditions. Acquisition of >5,000 events was performed. This antibody gave a positive signal in SH-SY5Y cells fixed with 80% methanol (5 min)/permeabilized with 0.1% PBS-Tween for 20 min used under the same conditions.