Anti-FOXP1 antibody (ab93807)
Key features and details
- Rabbit polyclonal to FOXP1
- Suitable for: IHC-P, WB, IP
- Reacts with: Mouse, Human
- Isotype: IgG
Overview
-
Product name
Anti-FOXP1 antibody
See all FOXP1 primary antibodies -
Description
Rabbit polyclonal to FOXP1 -
Host species
Rabbit -
Specificity
FOXP1 -
Tested applications
Suitable for: IHC-P, WB, IPmore details -
Species reactivity
Reacts with: Mouse, Human
Predicted to work with: Rat, Horse, Cow, Dog, Pig, Xenopus laevis, Chimpanzee, Rhesus monkey, Gorilla, Chinese hamster, Orangutan, Xenopus tropicalis, Elephant
-
Immunogen
Synthetic peptide corresponding to Human FOXP1 aa 627-677.
Sequence:MQAVHPVHVKEEPLDPEEAEGPLSLVTTANHSPDFDHDRDYEDEPVNEDM E
-
Positive control
- HeLa lysate and 293T cells
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. -
Storage buffer
pH: 7
Preservative: 0.09% Sodium azide
Constituent: Tris citrate/phosphate -
Concentration information loading... -
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Images
-
All lanes : Anti-FOXP1 antibody (ab93807) at 0.1 µg/ml
Lane 1 : HeLa lysate at 50 µg
Lane 2 : HeLa lysate at 15 µg
Lane 3 : HeLa lysate at 5 µg
Lane 4 : 293 T cells at 50 µg
Developed using the ECL technique.
Predicted band size: 75 kDa
Exposure time: 3 minutes
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-FOXP1 antibody (ab93807)Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human prostate carcinoma (left) and mouse hybridoma tumor (right) tissues labelling FOXP1 with ab93807 at 1/1000 (1µg/ml). Detection: DAB. -
Immunoprecipitation of FOXP1 in whole cell lysate from HeLa cells (1 mg for IP, 20% of IP loaded) using ab93807 at 3µg/mg lysate. Subsequent WB detections was performed using 1µg/ml ab93807.

