Call: +7 771 977 66 65, +7 705 421 2277
Sign in or Register
My basket

Astana Biomed Group, an authorized Abcam distributor in Central Asia

Abiomed homepage

  • Categories
    Signal Transduction
    Cancer
    Epigenetics and Nuclear Signaling
    Immunology
    Cell Biology
    Cardiovascular
    Neuroscience
    Tags & Cell Markers
    Kits/ Lysates/ Other
    Developmental Biology
    Microbiology
    Biochemicals
    Secondary antibodies
    Isotype/Loading Controls
    Antibody Arrays
  • About us
  • Partners
  • Contact
    Address

    Saryarka 32, 18, 010000, Astana city, Kazakhstan

    Telephone +7 771 977 66 65, +7 705 421 2277

    Email

    laboratory@ctlab.kz, orders@abiomed.kz

Back to category
Epigenetics and Nuclear Signaling Transcription Domain Families Forkhead Box

Anti-FOXP1 antibody (ab93807)

Anti-FOXP1 antibody (ab93807)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)

Key features and details

  • Rabbit polyclonal to FOXP1
  • Suitable for: IHC-P, WB, IP
  • Reacts with: Mouse, Human
  • Isotype: IgG

You may also be interested in

Product image
Anti-FOXC1 antibody (ab245443)
Product image
Recombinant Human E2F6 protein (ab114573)
Product image
Anti-FOXE1 antibody (ab236661)
Product image
Anti-FOXO3A (phospho S253) antibody (ab31109)

Overview

  • Product name

    Anti-FOXP1 antibody
    See all FOXP1 primary antibodies
  • Description

    Rabbit polyclonal to FOXP1
  • Host species

    Rabbit
  • Specificity

    FOXP1
  • Tested applications

    Suitable for: IHC-P, WB, IPmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Rat, Horse, Cow, Dog, Pig, Xenopus laevis, Chimpanzee, Rhesus monkey, Gorilla, Chinese hamster, Orangutan, Xenopus tropicalis, Elephant
  • Immunogen

    Synthetic peptide corresponding to Human FOXP1 aa 627-677.
    Sequence:

    MQAVHPVHVKEEPLDPEEAEGPLSLVTTANHSPDFDHDRDYEDEPVNEDM E

    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
  • Positive control

    • HeLa lysate and 293T cells
  • General notes

    Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.

    Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.

    We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.

    In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.

    We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.

    Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.

    Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
  • Storage buffer

    pH: 7
    Preservative: 0.09% Sodium azide
    Constituent: Tris citrate/phosphate
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

    • Epigenetics and Nuclear Signaling
    • Transcription
    • Domain Families
    • Forkhead Box
    • Epigenetics and Nuclear Signaling
    • Transcription
    • Domain Families
    • Forkhead Box
    • FOXP
    • Cancer
    • Oncoproteins/suppressors
    • Tumor suppressors
    • Other

Images

  • Western blot - Anti-FOXP1 antibody (ab93807)
    Western blot - Anti-FOXP1 antibody (ab93807)
    All lanes : Anti-FOXP1 antibody (ab93807) at 0.1 µg/ml

    Lane 1 : HeLa lysate at 50 µg
    Lane 2 : HeLa lysate at 15 µg
    Lane 3 : HeLa lysate at 5 µg
    Lane 4 : 293 T cells at 50 µg

    Developed using the ECL technique.

    Predicted band size: 75 kDa


    Exposure time: 3 minutes
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-FOXP1 antibody (ab93807)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-FOXP1 antibody (ab93807)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human prostate carcinoma (left) and mouse hybridoma tumor (right) tissues labelling FOXP1 with ab93807 at 1/1000 (1µg/ml). Detection: DAB.
  • Immunoprecipitation - Anti-FOXP1 antibody (ab93807)
    Immunoprecipitation - Anti-FOXP1 antibody (ab93807)
    Immunoprecipitation of FOXP1 in whole cell lysate from HeLa cells (1 mg for IP, 20% of IP loaded) using ab93807 at 3µg/mg lysate. Subsequent WB detections was performed using 1µg/ml ab93807.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Alternative products to Anti-FOXP1 antibody (ab93807)

  •  
  • Product image

    Alexa Fluor® 488 Anti-FOXP1 antibody [EPR4113] (ab197522)

    Applications: Flow Cyt, ICC/IF

  •  
  • Product image

    Alexa Fluor® 647 Anti-FOXP1 antibody [EPR4113] (ab196977)

    Applications: Flow Cyt, ICC/IF

  •  
  • Product image

    Anti-FOXP1 antibody (ab16645)

    Applications: IHC-FoFr, WB

  •  
  • Product image

    Anti-FOXP1 antibody [EPR4113] (ab134055)

    Applications: Flow Cyt, ICC/IF, IHC-P, WB

  •  
  • Product image

    Anti-FOXP1 antibody [JC12] (ab32010)

    Applications: IHC-P, WB

  •  
  • Product image

    Anti-FOXP1 antibody [JC12] - BSA and Azide free (ab264529)

    Applications: ICC/IF, IHC-P, WB

  •  
  • Product image

    Anti-FOXP1 antibody [SP133] - BSA and Azide free (ab245739)

    Applications: Flow Cyt, IHC-Fr, IHC-P, WB

  •  
  • Product image

    HRP Anti-FOXP1 antibody [EPR4113] (ab196978)

    Applications: WB

Get resources and offers direct to your inbox Sign up
© 2021 Astana Biomed Group LLP. All rights reserved.