Call: +7 771 977 66 65, +7 705 421 2277
Sign in or Register
My basket

Astana Biomed Group, an authorized Abcam distributor in Central Asia

Abiomed homepage

  • Categories
    Signal Transduction
    Cancer
    Epigenetics and Nuclear Signaling
    Immunology
    Cell Biology
    Cardiovascular
    Neuroscience
    Tags & Cell Markers
    Kits/ Lysates/ Other
    Developmental Biology
    Microbiology
    Biochemicals
    Secondary antibodies
    Isotype/Loading Controls
    Antibody Arrays
  • About us
  • Partners
  • Contact
    Address

    Saryarka 32, 18, 010000, Astana city, Kazakhstan

    Telephone +7 771 977 66 65, +7 705 421 2277

    Email

    laboratory@ctlab.kz, orders@abiomed.kz

Back to category
Signal Transduction Cytoskeleton / ECM Cytoskeleton Microfilaments Actin etc Actin Binding Proteins

Anti-Flightless I antibody (ab176805)

Anti-Flightless I antibody (ab176805)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)

Key features and details

  • Rabbit polyclonal to Flightless I
  • Suitable for: IHC-P, WB, IP
  • Reacts with: Human
  • Isotype: IgG

You may also be interested in

Product image
Anti-Flotillin 1 antibody (ab41927)
Product image
Human FSCN1 (Fascin) knockout HCT116 cell pellet (ab278993)
Product image
Anti-Sarcomeric Alpha Actinin antibody [EP2530Y] (ab68168)
Product image
Anti-Activin Receptor Type IA antibody [MM0052-9J17] (ab78414)

Overview

  • Product name

    Anti-Flightless I antibody
    See all Flightless I primary antibodies
  • Description

    Rabbit polyclonal to Flightless I
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WB, IPmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Chimpanzee
  • Immunogen

    Synthetic peptide within Human Flightless I aa 425-475. The exact sequence is proprietary. (NP_002009.1).
    Sequence:

    ARKMRLRRRKDSAQDDQAKQVLKGMSDVAQEKNKKQEESADARAPSGKVR R


    Database link: Q13045
    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
  • Positive control

    • HeLa and 293T whole cell lysates; Human breast carcinoma tissue.
  • General notes

    Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.

    Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.

    We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.

    In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.

    We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.

    Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.

    Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 6.8
    Preservative: 0.09% Sodium azide
    Constituents: 0.1% BSA, 99% Tris buffered saline
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    ab176805 was affinity purified using an epitope specific to Flightless I immobilized on solid support.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

    • Signal Transduction
    • Cytoskeleton / ECM
    • Cytoskeleton
    • Microfilaments
    • Actin etc
    • Actin Binding Proteins
    • Cell Biology
    • Cell Cycle
    • Cell differentiation
    • Stem Cells
    • Mesenchymal Stem Cells
    • Intracellular

Images

  • Western blot - Anti-Flightless I antibody (ab176805)
    Western blot - Anti-Flightless I antibody (ab176805)
    All lanes : Anti-Flightless I antibody (ab176805) at 0.04 µg/ml

    Lane 1 : HeLa whole cell lysate at 50 µg
    Lane 2 : HeLa whole cell lysate at 15 µg
    Lane 3 : HeLa whole cell lysate at 5 µg
    Lane 4 : 293T whole cell lysate at 50 µg

    Developed using the ECL technique.

    Predicted band size: 145 kDa


    Exposure time: 30 seconds
  • Immunoprecipitation - Anti-Flightless I antibody (ab176805)
    Immunoprecipitation - Anti-Flightless I antibody (ab176805)

    Detection of Flightless I in Immunoprecipitates of HeLa whole cell lysate (1 mg for IP, 20% of IP loaded) using ab176805 at 3 µg/mg lysate for IP (Lane 1) and at 1 µg/ml for subsequent Western blot detection. Lane 2 represents control IgG IP.

    Detection: Chemiluminescence with an exposure time of 10 seconds.

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Flightless I antibody (ab176805)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Flightless I antibody (ab176805)

    Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human breast carcinoma tissue labeling Flightless I with ab176805 at 1/200 dilution, followed by DAB staining.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Alternative products to Anti-Flightless I antibody (ab176805)

  •  
  • Product image

    Anti-Flightless I antibody (ab233001)

    Applications: IHC-P, WB

  •  
  • Product image

    Anti-Flightless I antibody - C-terminal (ab228616)

    Applications: ICC/IF, WB

  •  
  • Product image

    Anti-Flightless I antibody [EPR4201] (ab108594)

    Applications: ICC/IF, IHC-P, WB

  •  
  • Product image

    Anti-Flightless I antibody [EPR4202(2)] (ab109015)

    Applications: ICC/IF, IHC-P, WB

Clear all

Recently viewed products

  •  
  • Product image

    Anti-Axl antibody [EPR19880] (ab219651)

  •  
  • Product image

    Anti-Aldolase B antibody (ab153828)

  •  
  • Product image

    Anti-FARS2 antibody (ab231190)

  •  
  • Product image

    Anti-KIAA0513 antibody (ab121430)

  •  
  • Product image

    Anti-REC8 antibody (ab246985)

  •  
  • Anti-Hemoglobin antibody [7A4] (ab116628)

Get resources and offers direct to your inbox Sign up
© 2021 Astana Biomed Group LLP. All rights reserved.