Anti-CD22 antibody [2H1C4] (ab181771)
Key features and details
- Mouse monoclonal [2H1C4] to CD22
- Suitable for: ICC/IF, Flow Cyt, IHC-P, WB
- Reacts with: Mouse, Human
- Isotype: IgG1
Overview
-
Product name
Anti-CD22 antibody [2H1C4]
See all CD22 primary antibodies -
Description
Mouse monoclonal [2H1C4] to CD22 -
Host species
Mouse -
Tested Applications & Species
See all applications and species dataApplication Species Flow Cyt HumanICC/IF HumanIHC-P HumanWB MouseHuman -
Immunogen
Recombinant fragment corresponding to Human CD22 aa 621-725. expressed in E. Coli.
Sequence:NPPVSHYTWFDWNNQSLPYHSQKLRLEPVKVQHSGAYWCQGTNSVGKGRS PLSTLTVYYSPETIGRRVAVGLGSCLAILILAICGLKLQRRWKRTQSQQG LQENS
Database link: P20273 -
Positive control
- Human CD22 recombinant protein; HEK293 cell lysate, transfected with CD22 (amino acids 622-725); Mouse L1210, HeLa, HEK293, Jurkat, OCM-1, A432 and mouse NIH 3T3 cell lysates; HeLa cells; Human cervical cancer and cerebellum tissues.
-
General notes
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing the problem with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation.
One factor contributing to the crisis is the use of antibodies that are not suitable. This can lead to misleading results and the use of incorrect data informing project assumptions and direction. To help address this challenge, we have introduced an application and species grid on our primary antibody datasheets to make it easy to simplify identification of the right antibody for your needs.
Learn more here.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
Preservative: 0.05% Sodium azide
Constituent: 99% PBS -
Concentration information loading...
-
Purity
Protein G purified -
Purification notes
Purified from tissue culture supernatant. -
Clonality
Monoclonal -
Clone number
2H1C4 -
Isotype
IgG1 -
Research areas
Images
-
Flow cytometric analysis of HeLa cells labeling CD22 with ab181771 at 1/200 dilution (green); negative control (red).
-
Anti-CD22 antibody [2H1C4] (ab181771) at 1/500 dilution + Human CD22 recombinant protein
Predicted band size: 95 kDa
-
All lanes : Anti-CD22 antibody [2H1C4] (ab181771) at 1/500 dilution
Lane 1 : HEK293 cell lysate, non-transfected
Lane 2 : HEK293 cell lysate, transfected with CD22 (amino acids 622-725)-hIgGFc
Predicted band size: 95 kDa
-
All lanes : Anti-CD22 antibody [2H1C4] (ab181771) at 1/500 dilution
Lane 1 : mouse L1210 cell lysate
Lane 2 : HeLa cell lysate
Lane 3 : HEK293 cell lysate
Lane 4 : Jurkat cell lysate
Lane 5 : OCM-1 cell lysate
Lane 6 : A431 cell lysate
Lane 7 : mouse NIH 3T3 cell lysate
Predicted band size: 95 kDa
-
Immunofluorescent analysis of HeLa cells, labeling CD22 with ab181771 at 1/200 dilution (green). Blue: DRAQ5 fluorescent DNA dye. Red: Actin filaments have been labeled with Alexa Fluor-555 phalloidin.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-CD22 antibody [2H1C4] (ab181771)
Immunohistochemical analysis of paraffin-embedded Human cervical cancer tissue labeling CD22 with ab181771 at 1/200 dilution followed by DAB staining.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-CD22 antibody [2H1C4] (ab181771)
Immunohistochemical analysis of paraffin-embedded Human cerebellum tissue labeling CD22 with ab181771 at 1/200 dilution followed by DAB staining.