Anti-Caspase-3 antibody (ab90437)
Key features and details
- Rabbit polyclonal to Caspase-3
- Suitable for: WB, IHC-P
- Reacts with: Human, Saccharomyces cerevisiae
- Isotype: IgG
Overview
-
Product name
Anti-Caspase-3 antibody
See all Caspase-3 primary antibodies -
Description
Rabbit polyclonal to Caspase-3 -
Host species
Rabbit -
Tested applications
Suitable for: WB, IHC-Pmore details -
Species reactivity
Reacts with: Human, Saccharomyces cerevisiae -
Immunogen
Recombinant full length protein corresponding to Human Caspase-3 aa 1-277.
Sequence:MENTENSVDSKSIKNLEPKIIHGSESMDSGISLDNSYKMDYPEMGLCIII NNKNFHKSTGMTSRSGTDVDAANLRETFRNLKYEVRNKNDLTREEIVELM RDVSKEDHSKRSSFVCVLLSHGEEGIIFGTNGPVDLKKITNFFRGDRCRS LTGKPKLFIIQACRGTELDCGIETDSGVDDDMACHKIPVEADFLYAYSTA PGYYSWRNSKDGSWFIQSLCAMLKQYADKLEFMHILTRVNRKVATEFESF SFDATFHAKKQIPCIVSMLTKELYFYH
Database link: P42574 -
Positive control
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C. Avoid freeze / thaw cycle. -
Storage buffer
Preservative: 0.09% Sodium azide
Constituents: PBS, 50% Glycerol -
Concentration information loading... -
Purity
Protein A purified -
Purification notes
Affinity Purification -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Images
-
All lanes : Anti-Caspase-3 antibody (ab90437) at 1/1000 dilution
Lane 1 : Mouse hepatocytes whole cell lysate poly(I:C) treated - 0 hours
Lane 2 : Mouse hepatocytes whole cell lysate poly(I:C) treated - 12 hours
Developed using the ECL technique.
Predicted band size: 32 kDa
Observed band size: 32 kDa
Exposure time: 20 secondsBlocking with 5% milk for 1 hour at 23°C.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Caspase-3 antibody (ab90437)Immunohistochemistry analysis of human spleen tissue stained with Caspase-3, pAb at 10µg/ml.
-
All lanes : Anti-Caspase-3 antibody (ab90437) at 1/1000 dilution
Lane 1 : Jurkat cell lysate
Lane 2 : Jurkat cells treated with staurosporine
Lane 3 : MCF-7 cell lysate (negative control)
Developed using the ECL technique.
Predicted band size: 32 kDa
Additional bands at: ~18 kDa (possible cleavage fragment), ~20 kDa (possible cleavage fragment)Western blot analysis of Caspase-3 pAb.

