Call: +7 771 977 66 65, +7 705 421 2277
Sign in or Register
My basket

Astana Biomed Group, an authorized Abcam distributor in Central Asia

Abiomed homepage

  • Categories
    Signal Transduction
    Cancer
    Epigenetics and Nuclear Signaling
    Immunology
    Cell Biology
    Cardiovascular
    Neuroscience
    Tags & Cell Markers
    Kits/ Lysates/ Other
    Developmental Biology
    Microbiology
    Biochemicals
    Secondary antibodies
    Isotype/Loading Controls
    Antibody Arrays
  • About us
  • Partners
  • Contact
    Address

    Saryarka 32, 18, 010000, Astana city, Kazakhstan

    Telephone +7 771 977 66 65, +7 705 421 2277

    Email

    laboratory@ctlab.kz, orders@abiomed.kz

Back to category
Cancer Invasion/microenvironment Apoptosis Caspases

Anti-Caspase-3 antibody (ab90437)

Price and availability

321 638 ₸

Availability

Order now and get it on Thursday February 25, 2021

Anti-Caspase-3 antibody (ab90437)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)

Key features and details

  • Rabbit polyclonal to Caspase-3
  • Suitable for: WB, IHC-P
  • Reacts with: Human, Saccharomyces cerevisiae
  • Isotype: IgG

You may also be interested in

Product image
Human CASP8 (Caspase-8) knockout HeLa cell lysate (ab256857)
Product image
Q-DEVD-OPh, caspase-3 inhibitor (ab142037)
Product image
Anti-Caspase-11 antibody [EPR22717-11] (ab246496)
Caspase 10 Assay Kit (Fluorometric) (ab65662)

Overview

  • Product name

    Anti-Caspase-3 antibody
    See all Caspase-3 primary antibodies
  • Description

    Rabbit polyclonal to Caspase-3
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human, Saccharomyces cerevisiae
  • Immunogen

    Recombinant full length protein corresponding to Human Caspase-3 aa 1-277.
    Sequence:

    MENTENSVDSKSIKNLEPKIIHGSESMDSGISLDNSYKMDYPEMGLCIII NNKNFHKSTGMTSRSGTDVDAANLRETFRNLKYEVRNKNDLTREEIVELM RDVSKEDHSKRSSFVCVLLSHGEEGIIFGTNGPVDLKKITNFFRGDRCRS LTGKPKLFIIQACRGTELDCGIETDSGVDDDMACHKIPVEADFLYAYSTA PGYYSWRNSKDGSWFIQSLCAMLKQYADKLEFMHILTRVNRKVATEFESF SFDATFHAKKQIPCIVSMLTKELYFYH


    Database link: P42574
    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
  • Positive control

    • Jurkat whole cell lysate (ab7899), Jurkat cells treated with staurosporine (lysate), HeLa whole cell lysate (ab150035)
  • General notes

    Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.

    Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.

    We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.

    In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.

    We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.

    Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.

    Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.09% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Protein A purified
  • Purification notes

    Affinity Purification
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

    • Cell Biology
    • Apoptosis
    • Intracellular
    • Caspases etc
    • Caspases
    • Cancer
    • Invasion/microenvironment
    • Apoptosis
    • Caspases
    • Cell Biology
    • Proteolysis / Ubiquitin
    • Proteolytic enzymes
    • Other proteases
    • Metabolism
    • Pathways and Processes
    • Metabolism processes
    • Apoptosis
    • Cancer
    • Cell Death
    • Apoptosis
    • Apoptosis Markers
    • Caspases
    • Cancer
    • Cell Death
    • Apoptosis
    • Metabolism

Images

  • Western blot - Anti-Caspase-3 antibody (ab90437)
    Western blot - Anti-Caspase-3 antibody (ab90437) This image is courtesy of an anonymous abreview.
    All lanes : Anti-Caspase-3 antibody (ab90437) at 1/1000 dilution

    Lane 1 : Mouse hepatocytes whole cell lysate poly(I:C) treated - 0 hours
    Lane 2 : Mouse hepatocytes whole cell lysate poly(I:C) treated - 12 hours

    Developed using the ECL technique.

    Predicted band size: 32 kDa
    Observed band size: 32 kDa


    Exposure time: 20 seconds


    Blocking with 5% milk for 1 hour at 23°C.

    See Abreview

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Caspase-3 antibody (ab90437)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Caspase-3 antibody (ab90437)

    Immunohistochemistry analysis of human spleen tissue stained with Caspase-3, pAb at 10µg/ml.

  • Western blot - Anti-Caspase-3 antibody (ab90437)
    Western blot - Anti-Caspase-3 antibody (ab90437)
    All lanes : Anti-Caspase-3 antibody (ab90437) at 1/1000 dilution

    Lane 1 : Jurkat cell lysate
    Lane 2 : Jurkat cells treated with staurosporine
    Lane 3 : MCF-7 cell lysate (negative control)

    Developed using the ECL technique.

    Predicted band size: 32 kDa
    Additional bands at: ~18 kDa (possible cleavage fragment), ~20 kDa (possible cleavage fragment)



    Western blot analysis of Caspase-3 pAb.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Alternative products to Anti-Caspase-3 antibody (ab90437)

  •  
  • Product image

    Anti-Caspase-3 antibody [EPR18297] - BSA and Azide free (ab224271)

    Applications: IHC-P, IP, WB

  •  
  • Product image

    Anti-Caspase-3 antibody [E87] (ab32351)

    Applications: Flow Cyt, ICC/IF, IHC-P, IP, WB

  •  
  • Product image

    Anti-Caspase-3 antibody [E87] - BSA and Azide free (ab197202)

    Applications: Flow Cyt, ICC/IF, IHC-P, IP, WB

  •  
  • Product image

    Anti-Caspase-3 antibody [EPR18297] (ab184787)

    Applications: IHC-P, IP, WB

  •  
  • Product image

    Anti-Caspase-3 antibody (ab4051)

    Applications: IHC-P, WB

  •  
  • Product image

    Biotin Anti-Caspase-3 antibody [E87] (ab195905)

    Applications: IHC-P, WB

  •  
  • Product image

    Anti-Caspase-3 antibody (ab13847)

    Applications: ICC/IF, WB

Get resources and offers direct to your inbox Sign up
© 2021 Astana Biomed Group LLP. All rights reserved.