Anti-Angiotensinogen antibody (ab97381)
Key features and details
- Rabbit polyclonal to Angiotensinogen
- Suitable for: ICC/IF, WB, IHC-P
- Reacts with: Mouse, Rat, Human
- Isotype: IgG
Overview
-
Product name
Anti-Angiotensinogen antibody
See all Angiotensinogen primary antibodies -
Description
Rabbit polyclonal to Angiotensinogen -
Host species
Rabbit -
Tested applications
Suitable for: ICC/IF, WB, IHC-Pmore details -
Species reactivity
Reacts with: Mouse, Rat, Human -
Immunogen
Recombinant fragment corresponding to Human Angiotensinogen aa 1-446.
Sequence:MRKRAPQSEMAPAGVSLRATILCLLAWAGLAAGDRVYIHPFHLVIHNEST CEQLAKANAGKPKDPTFIPAPIQAKTSPVDEKALQDQLVLVAAKLDTEDK LRAAMVGMLANFLGFRIYGMHSELWGVVHGATVLSPTAVFGTLASLYLGA LDHTADRLQAILGVPWKDKNCTSRLDAHKVLSALQAVQGLLVAQGRADSQ AQLLLSTVVGVFTAPGLHLKQPFVQGLALYTPVVLPRSLDFTELDVAAEK IDRFMQAVTGWKTGCSLMGASVDSTLAFNTYVHFQGKMKGFSLLAEPQEF WVDNSTSVSVPMLSGMGTFQHWSDIQDNFSVTQVPFTESACLLLIQPHYA SDLDKVEGLTFQQNSLNWMKKLSPRTIHLTMPQLVLQGSYDLQDLLAQAE LPAILHTELNLQKLSNDRIRVGEVLNSIFFELEADEREPTESTQQL
Database link: P01019 -
Positive control
- WB: HepG2 lysate. Mouse and Rat plasma. IHC-P: Hepatocellular carcinoma Huh7 xenograft. ICC/IF: HepG2 cells.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.00
Preservative: 0.01% Thimerosal (merthiolate)
Constituents: 1.21% Tris, 0.75% Glycine, 10% Glycerol (glycerin, glycerine) -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Angiotensinogen antibody (ab97381)Immunohistochemical analysis of paraffin-embedded Hepatocellular carcinoma Huh7, using Angiotensinogen antibody (ab97381) at 1/100 dilution.
-
Anti-Angiotensinogen antibody (ab97381) at 1/1000 dilution + Rat plasma at 50 µg
Predicted band size: 53 kDa
-
HepG2 cells stained for Angiotensinogen using ab97381 at 1/200 dilution in ICC/IF.
-
Anti-Angiotensinogen antibody (ab97381) at 1/1000 dilution + Mouse plasma at 50 µg
Predicted band size: 53 kDa
-
Anti-Angiotensinogen antibody (ab97381) at 1/1000 dilution + HepG2 whole cell lysate at 30 µg
Predicted band size: 53 kDa
10% SDS PAGE