Call: +7 771 977 66 65, +7 705 421 2277
Sign in or Register
My basket

Astana Biomed Group, an authorized Abcam distributor in Central Asia

Abiomed homepage

  • Categories
    Signal Transduction
    Cancer
    Epigenetics and Nuclear Signaling
    Immunology
    Cell Biology
    Cardiovascular
    Neuroscience
    Tags & Cell Markers
    Kits/ Lysates/ Other
    Developmental Biology
    Microbiology
    Biochemicals
    Secondary antibodies
    Isotype/Loading Controls
    Antibody Arrays
  • About us
  • Partners
  • Contact
    Address

    Saryarka 32, 18, 010000, Astana city, Kazakhstan

    Telephone +7 771 977 66 65, +7 705 421 2277

    Email

    laboratory@ctlab.kz, orders@abiomed.kz

Back to category
Cardiovascular Blood Fibrinolysis / Thrombolysis

Anti-Angiotensinogen antibody (ab97381)

Price and availability

284 784 ₸

Availability

Order now and get it on Wednesday February 24, 2021

Anti-Angiotensinogen antibody (ab97381)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)

Key features and details

  • Rabbit polyclonal to Angiotensinogen
  • Suitable for: ICC/IF, WB, IHC-P
  • Reacts with: Mouse, Rat, Human
  • Isotype: IgG

You may also be interested in

Native Human Alpha Thrombin protein (ab81589)
Product image
Anti-PAI1 antibody [EPR17272-21] (ab182973)
Recombinant human Thrombopoietin protein (Animal Free) (ab217448)
Product image
Anti-PAI1 antibody [EPR21850-82] (ab222754)

Overview

  • Product name

    Anti-Angiotensinogen antibody
    See all Angiotensinogen primary antibodies
  • Description

    Rabbit polyclonal to Angiotensinogen
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
  • Immunogen

    Recombinant fragment corresponding to Human Angiotensinogen aa 1-446.
    Sequence:

    MRKRAPQSEMAPAGVSLRATILCLLAWAGLAAGDRVYIHPFHLVIHNEST CEQLAKANAGKPKDPTFIPAPIQAKTSPVDEKALQDQLVLVAAKLDTEDK LRAAMVGMLANFLGFRIYGMHSELWGVVHGATVLSPTAVFGTLASLYLGA LDHTADRLQAILGVPWKDKNCTSRLDAHKVLSALQAVQGLLVAQGRADSQ AQLLLSTVVGVFTAPGLHLKQPFVQGLALYTPVVLPRSLDFTELDVAAEK IDRFMQAVTGWKTGCSLMGASVDSTLAFNTYVHFQGKMKGFSLLAEPQEF WVDNSTSVSVPMLSGMGTFQHWSDIQDNFSVTQVPFTESACLLLIQPHYA SDLDKVEGLTFQQNSLNWMKKLSPRTIHLTMPQLVLQGSYDLQDLLAQAE LPAILHTELNLQKLSNDRIRVGEVLNSIFFELEADEREPTESTQQL


    Database link: P01019
    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
  • Positive control

    • WB: HepG2 lysate. Mouse and Rat plasma. IHC-P: Hepatocellular carcinoma Huh7 xenograft. ICC/IF: HepG2 cells.
  • General notes

    Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.

    Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.

    We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.

    In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.

    We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.

    Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.

    Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.00
    Preservative: 0.01% Thimerosal (merthiolate)
    Constituents: 1.21% Tris, 0.75% Glycine, 10% Glycerol (glycerin, glycerine)
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

    • Cardiovascular
    • Blood
    • Fibrinolysis / Thrombolysis
    • Cardiovascular
    • Blood
    • Other
    • Cardiovascular
    • Lipids / Lipoproteins
    • Lipid Metabolism
    • Cholesterol Metabolism
    • Signal Transduction
    • Signaling Pathway
    • G Protein Signaling
    • GPCR
    • Cardiovascular
    • Atherosclerosis
    • Lipoprotein metabolism
    • Cardiovascular
    • Atherosclerosis
    • Apoptosis
    • Cardiovascular
    • Atherosclerosis
    • Hypertension
    • Vasoconstriction
    • Other
    • Cardiovascular
    • Blood
    • Blood Pressure regulation
    • Cardiovascular
    • Heart
    • Cardiac arrhythmias
    • Cardiovascular
    • Heart
    • Apoptosis
    • Cardiovascular
    • Heart
    • Contractility
    • Inotropics
    • Cardiovascular
    • Vasculature
    • Vasoconstriction
    • Other
    • Cardiovascular
    • Vasculature
    • Vasodilation
    • Nitric oxide associated
    • Cardiovascular
    • Vasculature
    • Vasodilation
    • Other
    • Metabolism
    • Pathways and Processes
    • Metabolic signaling pathways
    • Lipid and lipoprotein metabolism
    • Cholesterol Metabolism
    • Metabolism
    • Pathways and Processes
    • Metabolic signaling pathways
    • Lipid and lipoprotein metabolism
    • Lipoprotein metabolism
    • Metabolism
    • Types of disease
    • Cancer
    • Metabolism
    • Types of disease
    • Heart disease

Images

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Angiotensinogen antibody (ab97381)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Angiotensinogen antibody (ab97381)
    Immunohistochemical analysis of paraffin-embedded Hepatocellular carcinoma Huh7, using Angiotensinogen antibody (ab97381) at 1/100 dilution.
  • Western blot - Anti-Angiotensinogen antibody (ab97381)
    Western blot - Anti-Angiotensinogen antibody (ab97381)
    Anti-Angiotensinogen antibody (ab97381) at 1/1000 dilution + Rat plasma at 50 µg

    Predicted band size: 53 kDa

  • Immunocytochemistry/ Immunofluorescence - Anti-Angiotensinogen antibody (ab97381)
    Immunocytochemistry/ Immunofluorescence - Anti-Angiotensinogen antibody (ab97381)

    HepG2 cells stained for Angiotensinogen using ab97381 at 1/200 dilution in ICC/IF. 

  • Western blot - Anti-Angiotensinogen antibody (ab97381)
    Western blot - Anti-Angiotensinogen antibody (ab97381)
    Anti-Angiotensinogen antibody (ab97381) at 1/1000 dilution + Mouse plasma at 50 µg

    Predicted band size: 53 kDa

  • Western blot - Anti-Angiotensinogen antibody (ab97381)
    Western blot - Anti-Angiotensinogen antibody (ab97381)
    Anti-Angiotensinogen antibody (ab97381) at 1/1000 dilution + HepG2 whole cell lysate at 30 µg

    Predicted band size: 53 kDa



    10% SDS PAGE

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Alternative products to Anti-Angiotensinogen antibody (ab97381)

  •  
  • Product image

    Anti-Angiotensinogen antibody [EPR2931] (ab108334)

    Applications: ICC/IF, IP, WB

  •  
  • Product image

    Anti-Angiotensinogen antibody [EPR2930(2)] (ab108294)

    Applications: WB

  •  
  • Product image

    Anti-Angiotensinogen antibody [EPR20599] (ab213705)

    Applications: IP, WB

  •  
  • Product image

    Anti-Angiotensinogen antibody [EPR3136Y] (ab81270)

    Applications: WB

  •  
  • Product image

    Anti-Angiotensinogen antibody [EPR22199-203] (ab229005)

    Applications: IHC-P, IP, WB

  •  
  • Product image

    Anti-Angiotensinogen antibody [EPR22199-203] - BSA and Azide free (ab238173)

    Applications: IHC-P, IP, WB

Clear all

Recently viewed products

  •  
  • Product image

    Anti-NeuroD1 antibody (ab60704)

  •  
  • Product image

    Anti-Lysozyme antibody [EPR2995] (ab91653)

  •  
  • Product image

    Anti-Myoferlin antibody [7D2] (ab76746)

  •  
  • Product image

    Anti-STK3/MST-2 antibody (ab236300)

  •  
  • Product image

    Anti-Rotatin antibody (ab122710)

  •  
  • Product image

    HRP Anti-GAPDH antibody [3E8AD9] - Loading Control (ab198306)

Get resources and offers direct to your inbox Sign up
© 2021 Astana Biomed Group LLP. All rights reserved.