Anti-AKT2 antibody [4H7] (ab175354)
Key features and details
- Mouse monoclonal [4H7] to AKT2
- Suitable for: ICC/IF, ChIP, IP, IHC-P, WB
- Reacts with: Mouse, Rat, Human, African green monkey
- Isotype: IgG1
Overview
-
Product name
Anti-AKT2 antibody [4H7]
See all AKT2 primary antibodies -
Description
Mouse monoclonal [4H7] to AKT2 -
Host species
Mouse -
Tested Applications & Species
See all applications and species dataApplication Species ChIP HumanICC/IF MouseHumanIHC-P HumanIP HumanWB Human -
Immunogen
Recombinant full length protein corresponding to Human AKT2 aa 1-481. (NP_001617) produced in HEK293T cell.
Sequence:MNEVSVIKEGWLHKRGEYIKTWRPRYFLLKSDGSFIGYKERPEAPDQTLP PLNNFSVAECQLMKTERPRPNTFVIRCLQWTTVIERTFHVDSPDEREEWM RAIQMVANSLKQRAPGEDPMDYKCGSPSDSSTTEEMEVAVSKARAKVTMN DFDYLKLLGKGTFGKVILVREKATGRYYAMKILRKEVIIAKDEVAHTVTE SRVLQNTRHPFLTALKYAFQTHDRLCFVMEYANGGELFFHLSRERVFTEE RARFYGAEIVSALEYLHSRDVVYRDIKLENLMLDKDGHIKITDFGLCKEG ISDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRL PFYNQDHERLFELILMEEIRFPRTLSPEAKSLLAGLLKKDPKQRLGGGPS DAKEVMEHRFFLSINWQDVVQKKLLPPFKPQVTSEVDTRYFDDEFTAQSI TITPPDRYDSLGLLELDQRTHFPQFSYSASIRE
Database link: P31751 -
Positive control
- MCF7, HeLa, HepG2, A549, 293T, Jurkat, A431, U2OS, COS7, 3T3 L1 and NRK whole celll lysates; AKT2 transfected U2OS cells; Human Medulla Oblongata tissue; Human Esophageal cancer tissue.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
Preservative: 0.05% Sodium azide
Constituents: 0.1% BSA, 69% PBS, 30% Glycerol (glycerin, glycerine) -
Concentration information loading...
-
Purity
Protein A purified -
Clonality
Monoclonal -
Clone number
4H7 -
Isotype
IgG1 -
Research areas
Images
-
All lanes : Anti-AKT2 antibody [4H7] (ab175354) at 1/1000 dilution
Lane 1 : MCF7 whole cell lysate
Lane 2 : HeLa whole cell lysate
Lane 3 : HepG2 whole cell lysate
Lane 4 : A549 whole cell lysate
Lane 5 : 293T whole cell lysate
Lane 6 : Jurkat whole cell lysate
Lane 7 : A431 whole cell lysate
Lane 8 : U2OS whole cell lysate
Lane 9 : COS7 whole cell lysate
Lane 10 : 3T3 L1 whole cell lysate
Lane 11 : NRK whole cell lysate
Lysates/proteins at 25 µg per lane.
Secondary
All lanes : goat anti-mouse-HRP at 1/20000 dilution
Developed using the ECL technique.
Predicted band size: 55 kDa
-
Immunofluorescent analysis of AKT2 (green) showing staining in the cytoplasm and nucleus of C2C12 cells (right) compared to a negative control without primary antibody (left). Formalin-fixed cells were permeabilized with 0.1% Triton X-100 in TBS for 5-10 minutes and blocked with 3% BSA-PBS for 30 minutes at room temperature. Cells were probed with an AKT2 monoclonal antibody (ab175354) in 3% BSA-PBS at a dilution of 1:20 and incubated overnight at 4 ºC in a humidified chamber. Cells were washed with PBST and incubated with a DyLight-conjugated secondary antibody in PBS at room temperature in the dark. F-actin (red) was stained with a fluorescent red phalloidin and nuclei (blue) were stained with Hoechst or DAPI. Images were taken at a magnification of 60x.
-
Immunofluorescent analysis of AKT2 (green) showing staining in the cytoplasm and nucleus of Hela cells (right) compared to a negative control without primary antibody (left). Formalin-fixed cells were permeabilized with 0.1% Triton X-100 in TBS for 5-10 minutes and blocked with 3% BSA-PBS for 30 minutes at room temperature. Cells were probed with an AKT2 monoclonal antibody (ab175354) in 3% BSA-PBS at a dilution of 1:20 and incubated overnight at 4 ºC in a humidified chamber. Cells were washed with PBST and incubated with a DyLight-conjugated secondary antibody in PBS at room temperature in the dark. F-actin (red) was stained with a fluorescent red phalloidin and nuclei (blue) were stained with Hoechst or DAPI. Images were taken at a magnification of 60x.
-
Immunofluorescent analysis of AKT2 (green) showing staining in the cytoplasm and nucleus of MCF-7 cells (right) compared to a negative control without primary antibody (left). Formalin-fixed cells were permeabilized with 0.1% Triton X-100 in TBS for 5-10 minutes and blocked with 3% BSA-PBS for 30 minutes at room temperature. Cells were probed with an AKT2 monoclonal antibody (ab175354) in 3% BSA-PBS at a dilution of 1:20 and incubated overnight at 4 ºC in a humidified chamber. Cells were washed with PBST and incubated with a DyLight-conjugated secondary antibody in PBS at room temperature in the dark. F-actin (red) was stained with a fluorescent red phalloidin and nuclei (blue) were stained with Hoechst or DAPI. Images were taken at a magnification of 60x.
-
Chromatin immunoprecipitation analysis of Akt1 and Akt2 was performed using cross-linked chromatin from 1 x 106 HCT116 colon carcinoma cells treated with serum for 0, 15, 30, and 60 minutes. Immunoprecipitation was performed with 1.0ul/100ul well volume of an Atk1 monoclonal antibody and an Akt2 monoclonal antibody (ab175354). Chromatin aliquots from ~1 x 105 cells were used per ChIP pull-down. Quantitative PCR data were done in quadruplicate using 1ul of eluted DNA in 2ul SYBR real-time PCR reactions containing primers to amplify -15kb upstream of the Egr1 gene or exon-1 of Egr1. PCR calibration curves were generated for each primer pair from a dilution series of sheared total genomic DNA. Quantitation of immunoprecipitated chromatin is presented as signal relative to the total amount of input chromatin. Results represent the mean +/- SEM for three experiments. A schematic representation of the Egr-1 locus is shown above the data where boxes represent exons (black boxes = translated regions, white boxes = untranslated regions); the zigzag line represents an intron; and the straight line represents upstream sequence. Regions amplified by Egr-1 primers are represented by black bars.
-
Immunohistochemical analysis of deparaffinized Human Esophageal cancer tissue labeling AKT2 with ab175354 at 1/200 dilution. Detection was performed using a goat anti-mouse HRP secondary antibody followed by colorimetric detection using DAB substrate.
-
Immunoprecipitation of AKT2 was performed on HeLa cells. The antigen:antibody complex was formed by incubating 750 µg whole cell lysate with 2 µg of ab175354. WB detection used ab175354 at 1/1000 dilution.
-
Immunohistochemical analysis of deparaffinized normal Human Medulla Oblongata tissue labeling AKT2 with ab175354 at 1/200 dilution. Detection was performed using a goat anti-mouse HRP secondary antibody followed by colorimetric detection using DAB substrate.
-
All lanes : Anti-AKT2 antibody [4H7] (ab175354) at 1/1000 dilution
Lane 1 : Non-transfected U2OS cells
Lane 2 : AKT2 transfected U2OS cells
Secondary
All lanes : goat anti-mouse-HRP at 1/20000 dilution
Predicted band size: 55 kDa