Call: +7 771 977 66 65, +7 705 421 2277
Sign in or Register
My basket

Astana Biomed Group, an authorized Abcam distributor in Central Asia

Abiomed homepage

  • Categories
    Signal Transduction
    Cancer
    Epigenetics and Nuclear Signaling
    Immunology
    Cell Biology
    Cardiovascular
    Neuroscience
    Tags & Cell Markers
    Kits/ Lysates/ Other
    Developmental Biology
    Microbiology
    Biochemicals
    Secondary antibodies
    Isotype/Loading Controls
    Antibody Arrays
  • About us
  • Partners
  • Contact
    Address

    Saryarka 32, 18, 010000, Astana city, Kazakhstan

    Telephone +7 771 977 66 65, +7 705 421 2277

    Email

    laboratory@ctlab.kz, orders@abiomed.kz

Back to category
Signal Transduction Protein Phosphorylation Ser / Thr Kinases PKB / AKT

Anti-AKT2 antibody [4H7] (ab175354)

Price and availability

284 784 ₸

Availability

Order now and get it on Tuesday March 02, 2021

Anti-AKT2 antibody [4H7] (ab175354)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)

Key features and details

  • Mouse monoclonal [4H7] to AKT2
  • Suitable for: ICC/IF, ChIP, IP, IHC-P, WB
  • Reacts with: Mouse, Rat, Human, African green monkey
  • Isotype: IgG1

You may also be interested in

Perifosine, Akt inhibitor (ab142055)
A 83-01, ALK4, 5 and 7 kinase inhibitor (ab142092)
Product image
Anti-AKT3 + AKT2 + AKT1 antibody [Y89] - BSA and Azide free (ab219588)
Active human AKT1 peptide (ab39919)

Overview

  • Product name

    Anti-AKT2 antibody [4H7]
    See all AKT2 primary antibodies
  • Description

    Mouse monoclonal [4H7] to AKT2
  • Host species

    Mouse
  • Tested Applications & Species

    Application Species
    ChIP
    Human
    ICC/IF
    Mouse
    Human
    IHC-P
    Human
    IP
    Human
    WB
    Human
    See all applications and species data
  • Immunogen

    Recombinant full length protein corresponding to Human AKT2 aa 1-481. (NP_001617) produced in HEK293T cell.
    Sequence:

    MNEVSVIKEGWLHKRGEYIKTWRPRYFLLKSDGSFIGYKERPEAPDQTLP PLNNFSVAECQLMKTERPRPNTFVIRCLQWTTVIERTFHVDSPDEREEWM RAIQMVANSLKQRAPGEDPMDYKCGSPSDSSTTEEMEVAVSKARAKVTMN DFDYLKLLGKGTFGKVILVREKATGRYYAMKILRKEVIIAKDEVAHTVTE SRVLQNTRHPFLTALKYAFQTHDRLCFVMEYANGGELFFHLSRERVFTEE RARFYGAEIVSALEYLHSRDVVYRDIKLENLMLDKDGHIKITDFGLCKEG ISDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRL PFYNQDHERLFELILMEEIRFPRTLSPEAKSLLAGLLKKDPKQRLGGGPS DAKEVMEHRFFLSINWQDVVQKKLLPPFKPQVTSEVDTRYFDDEFTAQSI TITPPDRYDSLGLLELDQRTHFPQFSYSASIRE


    Database link: P31751
    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
  • Positive control

    • MCF7, HeLa, HepG2, A549, 293T, Jurkat, A431, U2OS, COS7, 3T3 L1 and NRK whole celll lysates; AKT2 transfected U2OS cells; Human Medulla Oblongata tissue; Human Esophageal cancer tissue.
  • General notes

    Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.

    Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.

    We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.

    In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.

    We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.

    Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.

    Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.05% Sodium azide
    Constituents: 0.1% BSA, 69% PBS, 30% Glycerol (glycerin, glycerine)
  • Concentration information loading...
  • Purity

    Protein A purified
  • Clonality

    Monoclonal
  • Clone number

    4H7
  • Isotype

    IgG1
  • Research areas

    • Signal Transduction
    • Protein Phosphorylation
    • Ser / Thr Kinases
    • PKB / AKT
    • Cancer
    • Signal transduction
    • Protein phosphorylation
    • Serine/threonine kinases
    • AKT
    • Cardiovascular
    • Atherosclerosis
    • Diabetes associated
    • Cardiovascular
    • Heart
    • Cardiac metabolism
    • Metabolism
    • Types of disease
    • Diabetes
    • Metabolism
    • Types of disease
    • Heart disease

Images

  • Western blot - Anti-AKT2 antibody [4H7] (ab175354)
    Western blot - Anti-AKT2 antibody [4H7] (ab175354)
    All lanes : Anti-AKT2 antibody [4H7] (ab175354) at 1/1000 dilution

    Lane 1 : MCF7 whole cell lysate
    Lane 2 : HeLa whole cell lysate
    Lane 3 : HepG2 whole cell lysate
    Lane 4 : A549 whole cell lysate
    Lane 5 : 293T whole cell lysate
    Lane 6 : Jurkat whole cell lysate
    Lane 7 : A431 whole cell lysate
    Lane 8 : U2OS whole cell lysate
    Lane 9 : COS7 whole cell lysate
    Lane 10 : 3T3 L1 whole cell lysate
    Lane 11 : NRK whole cell lysate

    Lysates/proteins at 25 µg per lane.

    Secondary
    All lanes : goat anti-mouse-HRP at 1/20000 dilution

    Developed using the ECL technique.

    Predicted band size: 55 kDa

  • Immunocytochemistry/ Immunofluorescence - Anti-AKT2 antibody [4H7] (ab175354)
    Immunocytochemistry/ Immunofluorescence - Anti-AKT2 antibody [4H7] (ab175354)

    Immunofluorescent analysis of AKT2 (green) showing staining in the cytoplasm and nucleus of C2C12 cells (right) compared to a negative control without primary antibody (left). Formalin-fixed cells were permeabilized with 0.1% Triton X-100 in TBS for 5-10 minutes and blocked with 3% BSA-PBS for 30 minutes at room temperature. Cells were probed with an AKT2 monoclonal antibody (ab175354) in 3% BSA-PBS at a dilution of 1:20 and incubated overnight at 4 ºC in a humidified chamber. Cells were washed with PBST and incubated with a DyLight-conjugated secondary antibody in PBS at room temperature in the dark. F-actin (red) was stained with a fluorescent red phalloidin and nuclei (blue) were stained with Hoechst or DAPI. Images were taken at a magnification of 60x.

  • Immunocytochemistry/ Immunofluorescence - Anti-AKT2 antibody [4H7] (ab175354)
    Immunocytochemistry/ Immunofluorescence - Anti-AKT2 antibody [4H7] (ab175354)

    Immunofluorescent analysis of AKT2 (green) showing staining in the cytoplasm and nucleus of Hela cells (right) compared to a negative control without primary antibody (left). Formalin-fixed cells were permeabilized with 0.1% Triton X-100 in TBS for 5-10 minutes and blocked with 3% BSA-PBS for 30 minutes at room temperature. Cells were probed with an AKT2 monoclonal antibody (ab175354) in 3% BSA-PBS at a dilution of 1:20 and incubated overnight at 4 ºC in a humidified chamber. Cells were washed with PBST and incubated with a DyLight-conjugated secondary antibody in PBS at room temperature in the dark. F-actin (red) was stained with a fluorescent red phalloidin and nuclei (blue) were stained with Hoechst or DAPI. Images were taken at a magnification of 60x.

  • Immunocytochemistry/ Immunofluorescence - Anti-AKT2 antibody [4H7] (ab175354)
    Immunocytochemistry/ Immunofluorescence - Anti-AKT2 antibody [4H7] (ab175354)

    Immunofluorescent analysis of AKT2 (green) showing staining in the cytoplasm and nucleus of MCF-7 cells (right) compared to a negative control without primary antibody (left). Formalin-fixed cells were permeabilized with 0.1% Triton X-100 in TBS for 5-10 minutes and blocked with 3% BSA-PBS for 30 minutes at room temperature. Cells were probed with an AKT2 monoclonal antibody (ab175354) in 3% BSA-PBS at a dilution of 1:20 and incubated overnight at 4 ºC in a humidified chamber. Cells were washed with PBST and incubated with a DyLight-conjugated secondary antibody in PBS at room temperature in the dark. F-actin (red) was stained with a fluorescent red phalloidin and nuclei (blue) were stained with Hoechst or DAPI. Images were taken at a magnification of 60x.

  • ChIP - Anti-AKT2 antibody [4H7] (ab175354)
    ChIP - Anti-AKT2 antibody [4H7] (ab175354)

    Chromatin immunoprecipitation analysis of Akt1 and Akt2 was performed using cross-linked chromatin from 1 x 106 HCT116 colon carcinoma cells treated with serum for 0, 15, 30, and 60 minutes. Immunoprecipitation was performed with 1.0ul/100ul well volume of an Atk1 monoclonal antibody  and an Akt2 monoclonal antibody (ab175354). Chromatin aliquots from ~1 x 105 cells were used per ChIP pull-down. Quantitative PCR data were done in quadruplicate using 1ul of eluted DNA in 2ul SYBR real-time PCR reactions containing primers to amplify -15kb upstream of the Egr1 gene or exon-1 of Egr1. PCR calibration curves were generated for each primer pair from a dilution series of sheared total genomic DNA. Quantitation of immunoprecipitated chromatin is presented as signal relative to the total amount of input chromatin. Results represent the mean +/- SEM for three experiments. A schematic representation of the Egr-1 locus is shown above the data where boxes represent exons (black boxes = translated regions, white boxes = untranslated regions); the zigzag line represents an intron; and the straight line represents upstream sequence. Regions amplified by Egr-1 primers are represented by black bars.

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-AKT2 antibody [4H7] (ab175354)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-AKT2 antibody [4H7] (ab175354)

    Immunohistochemical analysis of deparaffinized Human Esophageal cancer tissue labeling AKT2 with ab175354 at 1/200 dilution. Detection was performed using a goat anti-mouse HRP secondary antibody followed by colorimetric detection using DAB substrate.

  • Immunoprecipitation - Anti-AKT2 antibody [4H7] (ab175354)
    Immunoprecipitation - Anti-AKT2 antibody [4H7] (ab175354)

    Immunoprecipitation of AKT2 was performed on HeLa cells. The antigen:antibody complex was formed by incubating 750 µg whole cell lysate with 2 µg of ab175354. WB detection used ab175354 at 1/1000 dilution.

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-AKT2 antibody [4H7] (ab175354)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-AKT2 antibody [4H7] (ab175354)

    Immunohistochemical analysis of deparaffinized normal Human Medulla Oblongata tissue labeling AKT2 with ab175354 at 1/200 dilution. Detection was performed using a goat anti-mouse HRP secondary antibody followed by colorimetric detection using DAB substrate. 

  • Western blot - Anti-AKT2 antibody [4H7] (ab175354)
    Western blot - Anti-AKT2 antibody [4H7] (ab175354)
    All lanes : Anti-AKT2 antibody [4H7] (ab175354) at 1/1000 dilution

    Lane 1 : Non-transfected U2OS cells
    Lane 2 : AKT2 transfected U2OS cells

    Secondary
    All lanes : goat anti-mouse-HRP at 1/20000 dilution

    Predicted band size: 55 kDa

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Alternative products to Anti-AKT2 antibody [4H7] (ab175354)

  •  
  • Product image

    Anti-AKT2 antibody [EP1676] (ab131168)

    Applications: WB

  •  
  • Product image

    Anti-AKT2 (phospho S474) antibody (ab38513)

    Applications: IHC-P, WB

  •  
  • Product image

    Anti-AKT2 antibody [EPR18211-280] (ab222602)

    Applications: sELISA

  •  
  • Product image

    Anti-AKT2 antibody [EPR18211-282] (ab222601)

    Applications: sELISA

  •  
  • Anti-AKT2 antibody (ab13991)

    Applications:

  •  
  • Product image

    Anti-AKT2 antibody (ab223617)

    Applications: ICC/IF, WB

  •  
  • Product image

    Anti-AKT2 antibody (ab264288)

    Applications: IP, WB

Clear all

Recently viewed products

  •  
  • Product image

    Anti-BORIS antibody [EP12204] (ab187163)

  •  
  • Product image

    Anti-Aldosterone antibody [EPPTX-R9-134-1] (ab241065)

Get resources and offers direct to your inbox Sign up
© 2021 Astana Biomed Group LLP. All rights reserved.