Recombinant mouse M-CSF protein (Animal Free) (ab217461)
Key features and details
- Expression system: Escherichia coli
- Purity: > 98% SDS-PAGE
- Active: Yes
- Suitable for: SDS-PAGE, Functional Studies
-
Product name
Recombinant mouse M-CSF protein (Animal Free)
See all M-CSF proteins and peptides -
Biological activity
Determined by its ability to stimulate the proliferation of murine M-NFS-60 cells. The expected ED50 is ≤ 1.0 ng/ml, corresponding to a specific activity of ≥ 1 x 106 units/mg.
-
Purity
> 98 % SDS-PAGE.
assessed also by HPLC -
Expression system
Escherichia coli -
Accession
-
Protein length
Protein fragment -
Animal free
Yes -
Nature
Recombinant -
-
Species
Mouse -
Sequence
MKEVSEHCSHMIGNGHLKVLQQLIDSQMETSCQIAFEFVD QEQLDDPVCYLKKAFFLVQDIIDETMRFKDNTPNANATER LQELSNNLNSCFTKDYEEQNKACVRTFHETPLQLLEKIKNFFNETKNLLE KDWNIFTKNCNNSFAKCSSRDVVTKP -
Predicted molecular weight
36 kDa -
Amino acids
33 to 187 -
Additional sequence information
homodimeric protein consisting of two 156 amino acid polypeptide subunits.
-
Preparation and Storage
-
Alternative names
- Colony stimulating factor 1
- Colony stimulating factor 1 (macrophage)
- Colony stimulating factor macrophage specific
see all -
Function
Granulocyte/macrophage colony-stimulating factors are cytokines that act in hematopoiesis by controlling the production, differentiation, and function of 2 related white cell populations of the blood, the granulocytes and the monocytes-macrophages. CSF-1 induces cells of the monocyte/macrophage lineage. It plays a role in immunological defenses, bone metabolism, lipoproteins clearance, fertility and pregnancy. -
Post-translational
modificationsGlycosylation and proteolytic cleavage yield different soluble forms. A high molecular weight soluble form is a proteoglycan containing chondroitin sulfate.
Isoform 1 is N- and O-glycosylated. Isoform 3 is N-glycosylated. -
Cellular localization
Cell membrane and Secreted > extracellular space. - Information by UniProt
