Call: +7 771 977 66 65, +7 705 421 2277
Sign in or Register
My basket

Astana Biomed Group, an authorized Abcam distributor in Central Asia

Abiomed homepage

  • Categories
    Signal Transduction
    Cancer
    Epigenetics and Nuclear Signaling
    Immunology
    Cell Biology
    Cardiovascular
    Neuroscience
    Tags & Cell Markers
    Kits/ Lysates/ Other
    Developmental Biology
    Microbiology
    Biochemicals
    Secondary antibodies
    Isotype/Loading Controls
    Antibody Arrays
  • About us
  • Partners
  • Contact
    Address

    Saryarka 32, 18, 010000, Astana city, Kazakhstan

    Telephone +7 771 977 66 65, +7 705 421 2277

    Email

    laboratory@ctlab.kz, orders@abiomed.kz

Back to category
Immunology Innate Immunity Macrophage / Inflamm.

Recombinant mouse IL-1 alpha protein (ab200282)

Key features and details

  • Expression system: Escherichia coli
  • Purity: > 97% SDS-PAGE
  • Endotoxin level:
  • Active: Yes
  • Suitable for: SDS-PAGE, Functional Studies, HPLC

You may also be interested in

Product image
Anti-Arp3 antibody [EPR10428(B)] (ab151729)
Product image
Anti-TLR2 antibody [EPR20302-119] (ab209216)
Anti-TLR2 antibody [6C2] (ab11864)
Product image
Human MIP5 Matched Antibody Pair Kit (ab222260)

Description

  • Product name

    Recombinant mouse IL-1 alpha protein
    See all IL-1 alpha proteins and peptides
  • Biological activity

    The ED50 as determined by a cell proliferation assay using mouse D10S cells is less than 2 pg/ml, corresponding to a specific activity of > 5.0 × 108 IU/mg.

  • Purity

    > 97 % SDS-PAGE.
    assessed also by HPLC analysis
  • Endotoxin level

  • Expression system

    Escherichia coli
  • Accession

    P01582
  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Mouse
    • Sequence

      SAPYTYQSDLRYKLMKLVRQKFVMNDSLNQTIYQDVDKHYLSTTWLNDLQ QEVKFDMYAYSSGGDDSKYPVTLKISDSQLFVSAQGEDQPVLLKELPETP KLITGSETDLIFFWKSINSKNYFTSAAYPELFIATKEQSRVHLARGLPSM TDFQIS
    • Predicted molecular weight

      18 kDa
    • Amino acids

      115 to 270
  • Associated products

      Specifications

      Our Abpromise guarantee covers the use of ab200282 in the following tested applications.

      The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

      • Applications

        SDS-PAGE

        Functional Studies

        HPLC

      • Form

        Lyophilized
      • Concentration information loading...

      Preparation and Storage

      • Stability and Storage

        Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

        pH: 7.40
        Constituent: 100% PBS

        Lyophilized from a 0.2 µm filtered concentrated solution

        This product is an active protein and may elicit a biological response in vivo, handle with caution.

      • Reconstitution
        We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL.

      General Info

      • Alternative names

        • BAF
        • FAF
        • Hematopoietin 1
        • Hematopoietin-1
        • IL 1 alpha
        • IL 1A
        • IL-1 alpha
        • Il-1a
        • IL1
        • IL1 ALPHA
        • IL1A
        • IL1A_HUMAN
        • IL1F1
        • Interleukin 1 alpha
        • Interleukin-1 alpha
        • Interleukin1 alpha
        • LAF
        • LEM
        • Preinterleukin 1 alpha
        • Pro interleukin 1 alpha
        see all
      • Function

        Produced by activated macrophages, IL-1 stimulates thymocyte proliferation by inducing IL-2 release, B-cell maturation and proliferation, and fibroblast growth factor activity. IL-1 proteins are involved in the inflammatory response, being identified as endogenous pyrogens, and are reported to stimulate the release of prostaglandin and collagenase from synovial cells.
      • Sequence similarities

        Belongs to the IL-1 family.
      • Domain

        The similarity among the IL-1 precursors suggests that the amino ends of these proteins serve some as yet undefined function.
      • Cellular localization

        Secreted. The lack of a specific hydrophobic segment in the precursor sequence suggests that IL-1 is released by damaged cells or is secreted by a mechanism differing from that used for other secretory proteins.
      • Target information above from: UniProt accession P01583 The UniProt Consortium
        The Universal Protein Resource (UniProt) in 2010
        Nucleic Acids Res. 38:D142-D148 (2010) .

        Information by UniProt

    Protocols

    To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.

    Click here to view the general protocols

    Datasheets and documents

    • Datasheet
  • References (0)

    Publishing research using ab200282? Please let us know so that we can cite the reference in this datasheet.

    ab200282 has not yet been referenced specifically in any publications.

    Preparation and Storage

    • Alternative names

      • BAF
      • FAF
      • Hematopoietin 1
      • Hematopoietin-1
      • IL 1 alpha
      • IL 1A
      • IL-1 alpha
      • Il-1a
      • IL1
      • IL1 ALPHA
      • IL1A
      • IL1A_HUMAN
      • IL1F1
      • Interleukin 1 alpha
      • Interleukin-1 alpha
      • Interleukin1 alpha
      • LAF
      • LEM
      • Preinterleukin 1 alpha
      • Pro interleukin 1 alpha
      see all
    • Function

      Produced by activated macrophages, IL-1 stimulates thymocyte proliferation by inducing IL-2 release, B-cell maturation and proliferation, and fibroblast growth factor activity. IL-1 proteins are involved in the inflammatory response, being identified as endogenous pyrogens, and are reported to stimulate the release of prostaglandin and collagenase from synovial cells.
    • Sequence similarities

      Belongs to the IL-1 family.
    • Domain

      The similarity among the IL-1 precursors suggests that the amino ends of these proteins serve some as yet undefined function.
    • Cellular localization

      Secreted. The lack of a specific hydrophobic segment in the precursor sequence suggests that IL-1 is released by damaged cells or is secreted by a mechanism differing from that used for other secretory proteins.
    • Target information above from: UniProt accession P01583 The UniProt Consortium
      The Universal Protein Resource (UniProt) in 2010
      Nucleic Acids Res. 38:D142-D148 (2010) .

      Information by UniProt

    Images

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Alternative products to Recombinant mouse IL-1 alpha protein (ab200282)

    •  
    • Recombinant mouse IL-1 alpha protein (ab9725)

      Applications: FuncS, SDS-PAGE

    •  
    • Product image

      Recombinant human IL-1 alpha protein (ab119165)

      Applications: FuncS, HPLC, SDS-PAGE

    •  
    • Recombinant rat IL-1 alpha protein (ab9877)

      Applications: FuncS, SDS-PAGE

    •  
    • Recombinant human IL-1 alpha protein (ab9615)

      Applications: FuncS, SDS-PAGE

    •  
    • Recombinant mouse IL-1 alpha protein (ab119727)

      Applications: FuncS, HPLC, SDS-PAGE

    Clear all

    Recently viewed products

    •  
    • Product image

      Anti-CBFb antibody (ab231345)

    •  
    • Product image

      Anti-STAT1 antibody (ab230428)

    •  
    • Product image

      Anti-SERPING1 antibody (ab97348)

    •  
    • Product image

      Recombinant Human PLGF protein (ab269160)

    Get resources and offers direct to your inbox Sign up
    © 2021 Astana Biomed Group LLP. All rights reserved.