Recombinant mouse IL-1 alpha protein (ab200282)
Key features and details
- Expression system: Escherichia coli
- Purity: > 97% SDS-PAGE
- Endotoxin level:
- Active: Yes
- Suitable for: SDS-PAGE, Functional Studies, HPLC
-
Product name
Recombinant mouse IL-1 alpha protein
See all IL-1 alpha proteins and peptides -
Biological activity
The ED50 as determined by a cell proliferation assay using mouse D10S cells is less than 2 pg/ml, corresponding to a specific activity of > 5.0 × 108 IU/mg.
-
Purity
> 97 % SDS-PAGE.
assessed also by HPLC analysis -
Endotoxin level
Expression system
Escherichia coliAccession
Protein length
Protein fragmentAnimal free
NoNature
Recombinant-
Species
Mouse -
Sequence
SAPYTYQSDLRYKLMKLVRQKFVMNDSLNQTIYQDVDKHYLSTTWLNDLQ QEVKFDMYAYSSGGDDSKYPVTLKISDSQLFVSAQGEDQPVLLKELPETP KLITGSETDLIFFWKSINSKNYFTSAAYPELFIATKEQSRVHLARGLPSM TDFQIS -
Predicted molecular weight
18 kDa -
Amino acids
115 to 270
Associated products
Specifications
Our Abpromise guarantee covers the use of ab200282 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
SDS-PAGE
Functional Studies
HPLC
-
Form
Lyophilized -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
pH: 7.40
Constituent: 100% PBS
Lyophilized from a 0.2 µm filtered concentrated solutionThis product is an active protein and may elicit a biological response in vivo, handle with caution.
-
ReconstitutionWe recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL.
General Info
-
Alternative names
- BAF
- FAF
- Hematopoietin 1
see all -
Function
Produced by activated macrophages, IL-1 stimulates thymocyte proliferation by inducing IL-2 release, B-cell maturation and proliferation, and fibroblast growth factor activity. IL-1 proteins are involved in the inflammatory response, being identified as endogenous pyrogens, and are reported to stimulate the release of prostaglandin and collagenase from synovial cells. -
Sequence similarities
Belongs to the IL-1 family. -
Domain
The similarity among the IL-1 precursors suggests that the amino ends of these proteins serve some as yet undefined function. -
Cellular localization
Secreted. The lack of a specific hydrophobic segment in the precursor sequence suggests that IL-1 is released by damaged cells or is secreted by a mechanism differing from that used for other secretory proteins. - Information by UniProt
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab200282 has not yet been referenced specifically in any publications.
Preparation and Storage
-
Alternative names
- BAF
- FAF
- Hematopoietin 1
see all -
Function
Produced by activated macrophages, IL-1 stimulates thymocyte proliferation by inducing IL-2 release, B-cell maturation and proliferation, and fibroblast growth factor activity. IL-1 proteins are involved in the inflammatory response, being identified as endogenous pyrogens, and are reported to stimulate the release of prostaglandin and collagenase from synovial cells. -
Sequence similarities
Belongs to the IL-1 family. -
Domain
The similarity among the IL-1 precursors suggests that the amino ends of these proteins serve some as yet undefined function. -
Cellular localization
Secreted. The lack of a specific hydrophobic segment in the precursor sequence suggests that IL-1 is released by damaged cells or is secreted by a mechanism differing from that used for other secretory proteins. - Information by UniProt