Recombinant Mouse CTLA4 protein (Tagged) (ab235718)
Key features and details
- Expression system: Escherichia coli
- Purity: > 90% SDS-PAGE
- Suitable for: SDS-PAGE, MS
-
Product name
Recombinant Mouse CTLA4 protein (Tagged)
See all CTLA4 proteins and peptides -
Purity
> 90 % SDS-PAGE. -
Expression system
Escherichia coli -
Accession
-
Protein length
Protein fragment -
Animal free
No -
Nature
Recombinant -
-
Species
Mouse -
Sequence
EAIQVTQPSVVLASSHGVASFPCEYSPSHNTDEVRVTVLRQTNDQMTEVC ATTFTEKNTVGFLDYPFCSGTFNESRVNLTIQGLRAVDTGLYLCKVELMY PPPYFVGMGNGTQIYVIDPEPCPDSD -
Predicted molecular weight
34 kDa including tags -
Amino acids
36 to 161 -
Additional sequence information
N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged. Extracellular domain.
-
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
Constituents: Tris buffer, 50% Glycerol (glycerin, glycerine)
Images
-
SDS-PAGE - Recombinant Mouse CTLA4 protein (Tagged) (ab235718)
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel using ab235718.
-
Mass Spectrometry - Recombinant Mouse CTLA4 protein (Tagged) (ab235718)Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of ab235718 could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Ctla4.
-
Mass Spectrometry - Recombinant Mouse CTLA4 protein (Tagged) (ab235718)Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of ab235718 could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Ctla4.
