Call: +7 771 977 66 65, +7 705 421 2277
Sign in or Register
My basket

Astana Biomed Group, an authorized Abcam distributor in Central Asia

Abiomed homepage

  • Categories
    Signal Transduction
    Cancer
    Epigenetics and Nuclear Signaling
    Immunology
    Cell Biology
    Cardiovascular
    Neuroscience
    Tags & Cell Markers
    Kits/ Lysates/ Other
    Developmental Biology
    Microbiology
    Biochemicals
    Secondary antibodies
    Isotype/Loading Controls
    Antibody Arrays
  • About us
  • Partners
  • Contact
    Address

    Saryarka 32, 18, 010000, Astana city, Kazakhstan

    Telephone +7 771 977 66 65, +7 705 421 2277

    Email

    laboratory@ctlab.kz, orders@abiomed.kz

Back to category
Signal Transduction Protein Phosphorylation Tyrosine Kinases Receptor Tyrosine Kinases

Recombinant human TIE2 protein (ab196080)

Recombinant human TIE2 protein (ab196080)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)

Key features and details

  • Expression system: Baculovirus infected Sf9 cells
  • Purity: >= 80% SDS-PAGE
  • Active: Yes
  • Tags: GST tag N-Terminus
  • Suitable for: SDS-PAGE, Functional Studies

You may also be interested in

Product image
Anti-Prolactin Receptor/PRL-R antibody [EPR7184(2)] (ab170935)
Product image
Recombinant Human ROR1 protein (Tagged) (ab269987)
Product image
Recombinant human EGFR (mutated C775S + T790M + L858R) protein (Active) (ab268458)
Product image
Anti-ROR2 antibody [Nt 2535-2835] (ab190145)

Description

  • Product name

    Recombinant human TIE2 protein
    See all TIE2 proteins and peptides
  • Biological activity

    Specific Activity: 1400 pmol/min/μg.

    Assay Conditions: Enzyme reaction is conducted in a buffer containing 50 mM HEPES (pH 7.5), 10 mM MgCl2, 1 mM EGTA, 200 μM ATP, 0.01% Brij-35, 2 μM substrate (Tyr Peptide 5, Z-lyte kinase assay kit), and enzyme at 37°C for 1 hour.

  • Purity

    >= 80 % SDS-PAGE.

  • Expression system

    Baculovirus infected Sf9 cells
  • Accession

    Q02763
  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      QLKRANVQRRMAQAFQNVREEPAVQFNSGTLALNRKVKNNPDPTIYPVLD WNDIKFQDVIGEGNFGQVLKARIKKDGLRMDAAIKRMKEYASKDDHRDFA GELEVLCKLGHHPNIINLLGACEHRGYLYLAIEYAPHGNLLDFLRKSRVL ETDPAFAIANSTASTLSSQQLLHFAADVARGMDYLSQKQFIHRDLAARNI LVGENYVAKIADFGLSRGQEVYVKKTMGRLPVRWMAIESLNYSVYTTNSD VWSYGVLLWEIVSLGGTPYCGMTCAELYEKLPQGYRLEKPLNCDDEVYDL MRQCWREKPYERPSFAQILVSLNRMLEERKTYVNTTLYEKFTYAGIDCSA EEAA
    • Predicted molecular weight

      66 kDa including tags
    • Amino acids

      771 to 1124
    • Tags

      GST tag N-Terminus
    • Additional sequence information

      GenBank Accession No. NM_000459

Preparation and Storage

  • Alternative names

    • Angiopoietin 1 receptor
    • Angiopoietin-1 receptor
    • CD202b
    • CD202b antigen
    • Endothelial tyrosine kinase
    • Endothelium specific receptor tyrosine kinase 2
    • hTIE 2
    • hTIE2
    • Hyk
    • p140 TEK
    • Soluble TIE2 variant 1
    • Soluble TIE2 variant 2
    • Tek
    • tek tyrosine kinase
    • TEK tyrosine kinase endothelial
    • tek tyrosine kinase, endothelial
    • TIE 2
    • TIE2
    • TIE2_HUMAN
    • Tunica interna endothelial cell kinase
    • Tyrosine kinase with Ig and EGF homology domains 2
    • Tyrosine kinase with Ig and EGF homology domains-2
    • Tyrosine protein kinase receptor TEK
    • Tyrosine protein kinase receptor TIE 2
    • Tyrosine-protein kinase receptor TEK
    • Tyrosine-protein kinase receptor TIE-2
    • Venous malformations multiple cutaneous and mucosal
    • VMCM
    • VMCM 1
    • VMCM1
    see all
  • Function

    Tyrosine-protein kinase that acts as cell-surface receptor for ANGPT1, ANGPT2 and ANGPT4 and regulates angiogenesis, endothelial cell survival, proliferation, migration, adhesion and cell spreading, reorganization of the actin cytoskeleton, but also maintenance of vascular quiescence. Has anti-inflammatory effects by preventing the leakage of proinflammatory plasma proteins and leukocytes from blood vessels. Required for normal angiogenesis and heart development during embryogenesis. Required for post-natal hematopoiesis. After birth, activates or inhibits angiogenesis, depending on the context. Inhibits angiogenesis and promotes vascular stability in quiescent vessels, where endothelial cells have tight contacts. In quiescent vessels, ANGPT1 oligomers recruit TEK to cell-cell contacts, forming complexes with TEK molecules from adjoining cells, and this leads to preferential activation of phosphatidylinositol 3-kinase and the AKT1 signaling cascades. In migrating endothelial cells that lack cell-cell adhesions, ANGT1 recruits TEK to contacts with the extracellular matrix, leading to the formation of focal adhesion complexes, activation of PTK2/FAK and of the downstream kinases MAPK1/ERK2 and MAPK3/ERK1, and ultimately to the stimulation of sprouting angiogenesis. ANGPT1 signaling triggers receptor dimerization and autophosphorylation at specific tyrosine residues that then serve as binding sites for scaffold proteins and effectors. Signaling is modulated by ANGPT2 that has lower affinity for TEK, can promote TEK autophosphorylation in the absence of ANGPT1, but inhibits ANGPT1-mediated signaling by competing for the same binding site. Signaling is also modulated by formation of heterodimers with TIE1, and by proteolytic processing that gives rise to a soluble TEK extracellular domain. The soluble extracellular domain modulates signaling by functioning as decoy receptor for angiopoietins. TEK phosphorylates DOK2, GRB7, GRB14, PIK3R1; SHC1 and TIE1.
  • Tissue specificity

    Detected in umbilical vein endothelial cells. Proteolytic processing gives rise to a soluble extracellular domain that is detected in blood plasma (at protein level). Predominantly expressed in endothelial cells and their progenitors, the angioblasts. Has been directly found in placenta and lung, with a lower level in umbilical vein endothelial cells, brain and kidney.
  • Involvement in disease

    Dominantly inherited venous malformations
    May play a role in a range of diseases with a vascular component, including neovascularization of tumors, psoriasis and inflammation.
  • Sequence similarities

    Belongs to the protein kinase superfamily. Tyr protein kinase family. Tie subfamily.
    Contains 3 EGF-like domains.
    Contains 3 fibronectin type-III domains.
    Contains 2 Ig-like C2-type (immunoglobulin-like) domains.
    Contains 1 protein kinase domain.
  • Domain

    The soluble extracellular domain is functionally active in angiopoietin binding and can modulate the activity of the membrane-bound form by competing for angiopoietins.
  • Post-translational
    modifications

    Proteolytic processing leads to the shedding of the extracellular domain (soluble TIE-2 alias sTIE-2).
    Autophosphorylated on tyrosine residues in response to ligand binding. Autophosphorylation occurs in trans, i.e. one subunit of the dimeric receptor phosphorylates tyrosine residues on the other subunit. Autophosphorylation occurs in a sequential manner, where Tyr-992 in the kinase activation loop is phosphorylated first, followed by autophosphorylation at Tyr-1108 and at additional tyrosine residues. ANGPT1-induced phosphorylation is impaired during hypoxia, due to increased expression of ANGPT2. Phosphorylation is important for interaction with GRB14, PIK3R1 and PTPN11. Phosphorylation at Tyr-1102 is important for interaction with SHC1, GRB2 and GRB7. Phosphorylation at Tyr-1108 is important for interaction with DOK2 and for coupling to downstream signal transduction pathways in endothelial cells. Dephosphorylated by PTPRB.
    Ubiquitinated. The phosphorylated receptor is ubiquitinated and internalized, leading to its degradation.
  • Cellular localization

    Cell membrane. Cell junction. Cell junction, focal adhesion. Cytoplasm, cytoskeleton. Secreted. Recruited to cell-cell contacts in quiescent endothelial cells. Colocalizes with the actin cytoskeleton and at actin stress fibers during cell spreading. Recruited to the lower surface of migrating cells, especially the rear end of the cell. Proteolytic processing gives rise to a soluble extracellular domain that is secreted.
  • Target information above from: UniProt accession Q02763 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt

Images

  • Functional Studies - Recombinant human TIE2 protein (ab196080)
    Functional Studies - Recombinant human TIE2 protein (ab196080)

    Specific activity of ab196080 was determined to be 5.2 pmol/min/μg

  • SDS-PAGE - Recombinant human TIE2 protein (ab196080)
    SDS-PAGE - Recombinant human TIE2 protein (ab196080)

    SDS-PAGE using 5 µg ab196080 (Lane 1). Lane 2 shows protein marker.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Alternative products to Recombinant human TIE2 protein (ab196080)

  •  
  • Product image

    Recombinant human TIE2 (mutated R849W) protein (Active) (ab186089)

    Applications: FuncS, SDS-PAGE

  •  
  • Product image

    Recombinant human TIE2 protein (ab129039)

    Applications: FuncS, SDS-PAGE

  •  
  • Recombinant Mouse TIE2 protein (ab54456)

    Applications: SDS-PAGE

  •  
  • Product image

    Recombinant Mouse TIE2 protein (ab206798)

    Applications: SDS-PAGE

  •  
  • Product image

    Recombinant Human TIE2 protein (Fc Chimera) (ab54435)

    Applications: ELISA, SDS-PAGE, WB

Clear all

Recently viewed products

  •  
  • Product image

    Anti-KDM5A / Jarid1A / RBBP2 antibody [EPR12742] (ab177486)

  •  
  • Product image

    Anti-ZFP36L1 (phospho S92) antibody [EPR19926] (ab204922)

  •  
  • Product image

    Anti-SQSTM1 / p62 (phospho S349) antibody [EPR20451] (ab211324)

  •  
  • Product image

    Anti-Desmin antibody [SP138] - C-terminal (ab227651)

  •  
  • Product image

    Anti-RIP2 antibody [AF28D3] (ab75257)

  •  
  • Product image

    Anti-Lactate Dehydrogenase antibody [98A-1F9BB1] (ab135396)

Get resources and offers direct to your inbox Sign up
© 2021 Astana Biomed Group LLP. All rights reserved.