Recombinant Human Myosin light chain 3 protein (ab158937)
Key features and details
- Expression system: Wheat germ
- Tags: GST tag N-Terminus
- Suitable for: ELISA, WB
-
Product name
Recombinant Human Myosin light chain 3 protein -
Expression system
Wheat germ -
Protein length
Full length protein -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
MAPKKPEPKKDDAKAAPKAAPAPAPPPEPERPKEVEFDASKIKIEFTPEQ IEEFKEAFMLFDRTPKCEMKITYGQCGDVLRALGQNPTQAEVLRVLGKPR QEELNTKMMDFETFLPMLQHISKNKDTGTYEDFVEGLRVFDKEGNGTVMG AELRHVLATLGERLTEDEVEKLMAGQEDSNGCINYEAFVKHIMSS -
Amino acids
1 to 195 -
Tags
GST tag N-Terminus
-
Preparation and Storage
-
Alternative names
- Cardiac myosin light chain 1
- CMH8
- CMLC1
see all -
Function
Regulatory light chain of myosin. Does not bind calcium. -
Involvement in disease
Defects in MYL3 are the cause of cardiomyopathy familial hypertrophic type 8 (CMH8) [MIM:608751]. Familial hypertrophic cardiomyopathy is a hereditary heart disorder characterized by ventricular hypertrophy, which is usually asymmetric and often involves the interventricular septum. The symptoms include dyspnea, syncope, collapse, palpitations, and chest pain. They can be readily provoked by exercise. The disorder has inter- and intrafamilial variability ranging from benign to malignant forms with high risk of cardiac failure and sudden cardiac death. CMH8 inheritance can be autosomal dominant or recessive.
Defects in MYL3 are the cause of cardiomyopathy familial hypertrophic with mid-left ventricular chamber type 1 (MVC1) [MIM:608751]. MVC1 is a very rare variant of familial hypertrophic cardiomyopathy, characterized by mid-left ventricular chamber thickening. -
Sequence similarities
Contains 3 EF-hand domains. -
Post-translational
modificationsThe N-terminus is blocked.
N-terminus is methylated by METTL11A/NTM1. - Information by UniProt