Call: +7 771 977 66 65, +7 705 421 2277
Sign in or Register
My basket

Astana Biomed Group, an authorized Abcam distributor in Central Asia

Abiomed homepage

  • Categories
    Signal Transduction
    Cancer
    Epigenetics and Nuclear Signaling
    Immunology
    Cell Biology
    Cardiovascular
    Neuroscience
    Tags & Cell Markers
    Kits/ Lysates/ Other
    Developmental Biology
    Microbiology
    Biochemicals
    Secondary antibodies
    Isotype/Loading Controls
    Antibody Arrays
  • About us
  • Partners
  • Contact
    Address

    Saryarka 32, 18, 010000, Astana city, Kazakhstan

    Telephone +7 771 977 66 65, +7 705 421 2277

    Email

    laboratory@ctlab.kz, orders@abiomed.kz

Back to category
Signal Transduction Cytoskeleton / ECM Cytoskeleton Motor Proteins Myosin

Recombinant Human heavy chain Myosin/MYH3 protein (ab114308)

Price and availability

381 945 ₸

Availability

Order now and get it on Tuesday March 09, 2021

Recombinant Human heavy chain Myosin/MYH3 protein (ab114308)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)

Key features and details

  • Expression system: Wheat germ
  • Suitable for: SDS-PAGE, ELISA, WB

You may also be interested in

Product image
Anti-MYH6 antibody [3-48 G5C7] (ab207926)
Product image
Anti-MYH6 + Slow Skeletal Myosin Heavy chain antibody [EPR10891(2)] - BSA and Azide free (ab250868)
Product image
Anti-heavy chain Myosin/MYH3 antibody (ab124205)
Product image
Human OBSCN knockout HeLa cell line (ab265496)

Description

  • Product name

    Recombinant Human heavy chain Myosin/MYH3 protein
  • Expression system

    Wheat germ
  • Accession

    P11055
  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      SSDTEMEVFGIAAPFLRKSEKERIEAQNQPFDAKTYCFVVDSKEEYAKGK IKSSQDGKVTVETEDNRTLVVKPEDVYAMNPPKFDRIEDMAMLTHLNEP
    • Predicted molecular weight

      37 kDa including tags
    • Amino acids

      2 to 100

Preparation and Storage

  • Alternative names

    • embryonic
    • fast skeletal muscle
    • HEMHC
    • Muscle embryonic myosin heavy chain
    • Muscle embryonic myosin heavy chain 3
    • MYH 3
    • Myh3
    • MYH3_HUMAN
    • MYHC EMB
    • MYHSE 1
    • MYHSE1
    • Myosin heavy chain
    • Myosin heavy chain 3
    • Myosin heavy chain 3 skeletal muscle embryonic
    • Myosin heavy chain fast skeletal muscle embryonic
    • Myosin Heavy Polypeptide 3
    • Myosin heavy polypeptide 3 skeletal muscle embryonic
    • Myosin skeletal heavy chain embryonic 1
    • Myosin-3
    • SMHCE
    see all
  • Function

    Muscle contraction.
  • Involvement in disease

    Defects in MYH3 are the cause of distal arthrogryposis type 2A (DA2A) [MIM:193700]; also known as Freeman-Sheldon syndrome (FSS). Distal arthrogryposis is a clinically and genetically heterogeneous group of disorders characterized by bone anomalies and joint contractures of the hands and feet, causing medially overlapping fingers, clenched fists, ulnar deviation of fingers, camptodactyly and positional foot deformities. It is a disorder of primary limb malformation without primary neurologic or muscle disease. DA2A is the most severe form of distal arthrogryposis. Affected individuals have contractures of the orofacial muscles, characterized by microstomia with pouting lips, H-shaped dimpling of the chin, deep nasolabial folds, and blepharophimosis. Dysphagia, failure to thrive, growth deficit, and life-threatening respiratory complications (caused by structural anomalies of the oropharynx and upper airways) are frequent. Inheritance is autosomal dominant.
    Defects in MYH3 are the cause of distal arthrogryposis type 2B (DA2B) [MIM:601680]; also known as Sheldon-Hall syndrome (SHS) or arthrogryposis multiplex congenita distal type 2B (AMCD2B). DA2B is a form of inherited multiple congenital contractures. Affected individuals have vertical talus, ulnar deviation in the hands, severe camptodactyly, and a distinctive face characterized by a triangular shape, prominent nasolabial folds, small mouth and a prominent chin. DA2B is the most common of the distal arthrogryposis syndromes. It is similar to DA2A but the facial contractures are less dramatic.
  • Sequence similarities

    Contains 1 IQ domain.
    Contains 1 myosin head-like domain.
  • Developmental stage

    Abundantly present in fetal skeletal muscle and not present or barely detectable in heart and adult skeletal muscle.
  • Domain

    The rodlike tail sequence is highly repetitive, showing cycles of a 28-residue repeat pattern composed of 4 heptapeptides, characteristic for alpha-helical coiled coils.
    Each myosin heavy chain can be split into 1 light meromyosin (LMM) and 1 heavy meromyosin (HMM). It can later be split further into 2 globular subfragments (S1) and 1 rod-shaped subfragment (S2).
  • Cellular localization

    Cytoplasm > myofibril. Thick filaments of the myofibrils.
  • Target information above from: UniProt accession P11055 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt

Images

  • SDS-PAGE - Recombinant Human heavy chain Myosin/MYH3 protein (ab114308)
    SDS-PAGE - Recombinant Human heavy chain Myosin/MYH3 protein (ab114308)
    SDS-PAGE analysis of ab114308 on a 12.5% gel stained with Coomassie Blue.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Clear all

Recently viewed products

  •  
  • Product image

    Anti-Zika Virus NS1 antibody [B4] (ab218546)

  •  
  • Product image

    Anti-Lysosomal acid lipase/LAL antibody (ab154356)

  •  
  • Rabbit Anti-Guinea pig IgG H&L (HRP) (ab102360)

  •  
  • ML7, myosin light chain kinase inhibitor (ab120848)

  •  
  • Product image

    Anti-KIF6/Kinesin-13 antibody (ab72702)

  •  
  • Product image

    p27 KIP 1 overexpression 293T lysate (whole cell) (ab94318)

Get resources and offers direct to your inbox Sign up
© 2021 Astana Biomed Group LLP. All rights reserved.