Recombinant Human FGF22 protein (ab255999)
Key features and details
- Expression system: Escherichia coli
- Purity: >= 95% SDS-PAGE
- Endotoxin level:
- Suitable for: SDS-PAGE
-
Product name
Recombinant Human FGF22 protein
See all FGF22 proteins and peptides -
Purity
>= 95 % SDS-PAGE. -
Endotoxin level
Expression system
Escherichia coliAccession
Protein length
Full length proteinAnimal free
NoNature
Recombinant-
Species
Human -
Sequence
MTPSASRGPRSYPHLEGDVRWRRLFSSTHFFLRVDPGGRVQGTRWRHGQD SILEIRSVHVGVVVIKAVSSGFYVAMNRRGRLYGSRLYTVDCRFRERIEE NGHNTYASQRWRRRGQPMFLALDRRGGPRPGGRTRRYHLSAHFLPVLVS -
Predicted molecular weight
17 kDa -
Amino acids
23 to 170 -
Additional sequence information
Full-length mature chain lacking the signal peptide.
Associated products
-
Related Products
Specifications
Our Abpromise guarantee covers the use of ab255999 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
SDS-PAGE
-
Form
Lyophilized -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at room temperature. Store at -20°C.
Constituent: 0.1% Trifluoroacetic acid
0.2 micron filtered. -
ReconstitutionReconstitute in sterile water to 0.1 mg/ml. Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80°C and avoid repeat freeze thaws.
General Info
-
Alternative names
- FGF 22
- FGF-22
- FGF22
see all -
Function
May be involved in hair development. -
Sequence similarities
Belongs to the heparin-binding growth factors family. -
Cellular localization
Secreted. - Information by UniProt
Images
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
References (0)
ab255999 has not yet been referenced specifically in any publications.
Preparation and Storage
-
Stability and Storage
Shipped at room temperature. Store at -20°C.
Constituent: 0.1% Trifluoroacetic acid
0.2 micron filtered. -
ReconstitutionReconstitute in sterile water to 0.1 mg/ml. Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80°C and avoid repeat freeze thaws.