Call: +7 771 977 66 65, +7 705 421 2277
Sign in or Register
My basket

Astana Biomed Group, an authorized Abcam distributor in Central Asia

Abiomed homepage

  • Categories
    Signal Transduction
    Cancer
    Epigenetics and Nuclear Signaling
    Immunology
    Cell Biology
    Cardiovascular
    Neuroscience
    Tags & Cell Markers
    Kits/ Lysates/ Other
    Developmental Biology
    Microbiology
    Biochemicals
    Secondary antibodies
    Isotype/Loading Controls
    Antibody Arrays
  • About us
  • Partners
  • Contact
    Address

    Saryarka 32, 18, 010000, Astana city, Kazakhstan

    Telephone +7 771 977 66 65, +7 705 421 2277

    Email

    laboratory@ctlab.kz, orders@abiomed.kz

Back to category

Recombinant Human EpCAM protein (Tagged) (Biotin) (ab269993)

Recombinant Human EpCAM protein (Tagged) (Biotin) (ab269993)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)

Key features and details

  • Expression system: HEK 293 cells
  • Purity: >= 90% SDS-PAGE
  • Tags: His tag C-Terminus, Avi tag C-Terminus
  • Suitable for: SDS-PAGE

You may also be interested in

Agarose Anti-S tag antibody (ab19369)
Product image
Anti-DCTN3 antibody [EPR5097] - BSA and Azide free (ab232440)
Product image
Anti-SFT2D2 antibody (ab236899)
Product image
Anti-BrdU antibody [IIB5] (ab8152)

Description

  • Product name

    Recombinant Human EpCAM protein (Tagged) (Biotin)
    See all EpCAM proteins and peptides
  • Purity

    >= 90 % SDS-PAGE.

  • Expression system

    HEK 293 cells
  • Accession

    P16422
  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      QEECVCENYKLAVNCFVNNNRQCQCTSVGAQNTVICSKLAAKCLVMKAEM NGSKLGRRAKPEGALQNNDGLYDPDCDESGLFKAKQCNGTSMCWCVNTAG VRRTDKDTEITCSERVRTYWIIIELKHKAREKPYDSKSLRTALQKEITTR YQLDPKFITSILYENNVITIDLVQNSSQKTQNDVDIADVAYYFEKDVKGE SLFHSKKMDLTVNGEQLDLDPGQTLIYYVDEKAPEFSMQGLK
    • Predicted molecular weight

      31 kDa including tags
    • Amino acids

      24 to 265
    • Tags

      His tag C-Terminus , Avi tag C-Terminus
    • Additional sequence information

      NM_178135. Extracellular domain.
  • Conjugation

    Biotin

Preparation and Storage

  • Alternative names

    • 17 1A
    • 323/A3
    • Adenocarcinoma associated antigen
    • Adenocarcinoma-associated antigen
    • Antigen identified by monoclonal antibody AUA1
    • AUA1
    • CD326
    • CD326 antigen
    • Cell surface glycoprotein Trop 1
    • Cell surface glycoprotein Trop 2
    • Cell surface glycoprotein Trop-1
    • CO 17A
    • CO17 1A
    • CO17A
    • DIAR5
    • EGP
    • EGP 2
    • EGP2
    • EGP314
    • EGP40
    • Ep CAM
    • Ep-CAM
    • EPCAM
    • EPCAM_HUMAN
    • EpCAM1
    • Epithelial cell adhesion molecule
    • Epithelial Cell Adhesion Molecule Intracellular Domain (EpCAM-ICD)
    • Epithelial cell surface antigen
    • Epithelial cellular adhesion molecule
    • Epithelial glycoprotein
    • Epithelial glycoprotein 1
    • Epithelial glycoprotein 314
    • ESA
    • GA733 1
    • GA733 2
    • GA733-2
    • gastrointestinal tumor-associated antigen 2, 35-KD glycoprotein
    • gp4
    • hEGP 2
    • hEGP314
    • HNPCC8
    • Human epithelial glycoprotein 2
    • KS 1/4 antigen
    • KS1/4
    • KSA
    • Ly74
    • Lymphocyte antigen 74
    • M1S 1
    • M1S2
    • M4S1
    • Major gastrointestinal tumor associated protein GA733 2
    • Major gastrointestinal tumor-associated protein GA733-2
    • mEGP314
    • Membrane component chromosome 4 surface marker (35kD glycoprotein)
    • Membrane component, chromosome 4, surface marker
    • Membrane component, chromosome 4, surface marker 1
    • MIC18
    • MK 1
    • Protein 289A
    • TACD1
    • TACSTD1
    • TROP1
    • Tumor associated calcium signal transducer 1
    • Tumor associated calcium signal transducer 2 precursor
    • Tumor-associated calcium signal transducer 1
    see all
  • Function

    May act as a physical homophilic interaction molecule between intestinal epithelial cells (IECs) and intraepithelial lymphocytes (IELs) at the mucosal epithelium for providing immunological barrier as a first line of defense against mucosal infection. Plays a role in embryonic stem cells proliferation and differentiation. Up-regulates the expression of FABP5, MYC and cyclins A and E.
  • Tissue specificity

    Highly and selectively expressed by undifferentiated rather than differentiated embryonic stem cells (ESC). Levels rapidly diminish as soon as ESC's differentiate (at protein levels). Expressed in almost all epithelial cell membranes but not on mesodermal or neural cell membranes. Found on the surface of adenocarcinoma.
  • Involvement in disease

    Defects in EPCAM are the cause of diarrhea type 5 (DIAR5) [MIM:613217]. It is an intractable diarrhea of infancy characterized by villous atrophy and absence of inflammation, with intestinal epithelial cell dysplasia manifesting as focal epithelial tufts in the duodenum and jejunum.
    Defects in EPCAM are a cause of hereditary non-polyposis colorectal cancer type 8 (HNPCC8) [MIM:613244]. HNPCC is a disease associated with marked increase in cancer susceptibility. It is characterized by a familial predisposition to early-onset colorectal carcinoma (CRC) and extra-colonic tumors of the gastrointestinal, urological and female reproductive tracts. HNPCC is reported to be the most common form of inherited colorectal cancer in the Western world. Clinically, HNPCC is often divided into two subgroups. Type I is characterized by hereditary predisposition to colorectal cancer, a young age of onset, and carcinoma observed in the proximal colon. Type II is characterized by increased risk for cancers in certain tissues such as the uterus, ovary, breast, stomach, small intestine, skin, and larynx in addition to the colon. Diagnosis of classical HNPCC is based on the Amsterdam criteria: 3 or more relatives affected by colorectal cancer, one a first degree relative of the other two; 2 or more generation affected; 1 or more colorectal cancers presenting before 50 years of age; exclusion of hereditary polyposis syndromes. The term 'suspected HNPCC' or 'incomplete HNPCC' can be used to describe families who do not or only partially fulfill the Amsterdam criteria, but in whom a genetic basis for colon cancer is strongly suspected. Note=HNPCC8 results from heterozygous deletion of 3-prime exons of EPCAM and intergenic regions directly upstream of MSH2, resulting in transcriptional read-through and epigenetic silencing of MSH2 in tissues expressing EPCAM.
  • Sequence similarities

    Belongs to the EPCAM family.
    Contains 1 thyroglobulin type-1 domain.
  • Post-translational
    modifications

    Hyperglycosylated in carcinoma tissue as compared with autologous normal epithelia. Glycosylation at Asn-198 is crucial for protein stability.
  • Cellular localization

    Lateral cell membrane. Cell junction > tight junction. Co-localizes with CLDN7 at the lateral cell membrane and tight junction.
  • Target information above from: UniProt accession P16422 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt

Images

  • SDS-PAGE - (ab269993)
    SDS-PAGE - (ab269993)

    SDS-PAGE anlysis of ab269993 (3 μg) on a 4-20% gel with Coomassies staining.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Alternative products to Recombinant Human EpCAM protein (Tagged) (Biotin) (ab269993)

  •  
  • Product image

    Recombinant human EpCAM protein (ab155637)

    Applications: FuncS, SDS-PAGE

  •  
  • Product image

    Recombinant Human EpCAM protein (Tagged) (ab269992)

    Applications: SDS-PAGE

  •  
  • Product image

    Recombinant Rhesus monkey EpCAM protein (His tag) (ab226418)

    Applications: SDS-PAGE

Clear all

Recently viewed products

  •  
  • Product image

    Anti-MRP4 antibody [EPR20403] (ab233382)

  •  
  • Product image

    FITC Anti-CD14 antibody [MEM-15] (ab28061)

  •  
  • Product image

    Anti-Transmembrane protein 93/EMC6 antibody (ab84902)

  •  
  • Product image

    Human Thrombin Antibody Pair - BSA and Azide free (ab253308)

  •  
  • Product image

    Recombinant human IDH2 (mutated R140Q) protein (ab198153)

  •  
  • Recombinant human IL-10 protein (Animal Free) (ab217418)

Get resources and offers direct to your inbox Sign up
© 2021 Astana Biomed Group LLP. All rights reserved.