Anti-Transmembrane protein 93/EMC6 antibody (ab84902)
Key features and details
- Rabbit polyclonal to Transmembrane protein 93/EMC6
- Suitable for: WB, IP
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-Transmembrane protein 93/EMC6 antibody
See all Transmembrane protein 93/EMC6 primary antibodies -
Description
Rabbit polyclonal to Transmembrane protein 93/EMC6 -
Host species
Rabbit -
Tested Applications & Species
See all applications and species dataApplication Species IP HumanWB Human -
Immunogen
Synthetic peptide within Human Transmembrane protein 93/EMC6 aa 2-51 (N terminal). The exact sequence is proprietary.
Sequence:AAVVAKREGPPFISEAAVRGNAAVLDYCRTSVSALSGATAGILGLTGLYG
Database link: NP_112588 -
Positive control
- WB: Jurkat whole cell lysate (ab7899). IP: HEK293 whole cell lysate.
-
General notes
This product was previously labelled as Transmembrane protein 93
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.2
Preservative: 0.09% Sodium azide
Constituents: 2% Sucrose, PBS -
Concentration information loading... -
Purity
Immunogen affinity purified -
Purification notes
ab84902 is purified by a peptide affinity chromatography method. -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Images
-
Anti-Transmembrane protein 93/EMC6 antibody (ab84902) at 1 µg/ml (in 5% skim milk / PBS buffer) + Jurkat cell lysate at 10 µg
Secondary
anti-Rabbit IgG HRP at 1/50000 dilution
Predicted band size: 12 kDa
Observed band size: 12 kDa
Gel concentration 10-20% -
ab84902 immunoprecipitating Transmembrane protein 93/EMC6 in HEK293 whole cell lysate. 2 mg whole cell lyaste was incubated with primary antibody ab84902 (1/200). For western blotting, ab84902 (1/1000) was used to confirm successful immunoprecipitation.
All lanes :
Lane 1 : Control IP in HEK293 whole cell lysate
Lane 2 : EMC6 IP with ab84902 in HEK293 whole cell lysate
Lane 3 : Input of HEK293 whole cell lysate

