Recombinant human CD8 alpha protein (Active) (ab242436)
Key features and details
- Expression system: CHO cells
- Purity: > 95% SDS-PAGE
- Active: Yes
- Suitable for: Functional Studies, HPLC, SDS-PAGE
-
Product name
Recombinant human CD8 alpha protein (Active)
See all CD8 alpha proteins and peptides -
Biological activity
Determined by its ability to induce plate adhesion of PHA-stimulated Jurkat cells.
-
Purity
> 95 % SDS-PAGE.
Greater than 95% by SDS-PAGE gel and HPLC analyses. Due to glycosylation, it migrates at an apparent molecular weight of approximately 27-29 kDa by SDS-PAGE analysis, under reducing conditions. -
Expression system
CHO cells -
Accession
-
Protein length
Protein fragment -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
SQFRVSPLDRTWNLGETVELKCQVLLSNPTSGCSWLFQPRGAAASPTFLL YLSQNKPKAAEGLDTQRFSGKRLGDTFVLTLSDFRRENEGYYFCSALSNS IMYFSHFVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGA VHTRGLDFACD -
Predicted molecular weight
18 kDa -
Amino acids
22 to 182 -
Additional sequence information
Extracellular domain.
-
Preparation and Storage
-
Alternative names
- alpha polypeptide (p32)
- CD_antigen=CD8a
- CD8
see all -
Function
Identifies cytotoxic/suppressor T-cells that interact with MHC class I bearing targets. CD8 is thought to play a role in the process of T-cell mediated killing. CD8 alpha chains binds to class I MHC molecules alpha-3 domains. -
Involvement in disease
Defects in CD8A are a cause of familial CD8 deficiency (CD8 deficiency) [MIM:608957]. Familial CD8 deficiency is a novel autosomal recessive immunologic defect characterized by absence of CD8+ cells, leading to recurrent bacterial infections. -
Sequence similarities
Contains 1 Ig-like V-type (immunoglobulin-like) domain. -
Post-translational
modificationsAll of the five most carboxyl-terminal cysteines form inter-chain disulfide bonds in dimers and higher multimers, while the four N-terminal cysteines do not. -
Cellular localization
Secreted and Cell membrane. - Information by UniProt
