Call: +7 771 977 66 65, +7 705 421 2277
Sign in or Register
My basket

Astana Biomed Group, an authorized Abcam distributor in Central Asia

Abiomed homepage

  • Categories
    Signal Transduction
    Cancer
    Epigenetics and Nuclear Signaling
    Immunology
    Cell Biology
    Cardiovascular
    Neuroscience
    Tags & Cell Markers
    Kits/ Lysates/ Other
    Developmental Biology
    Microbiology
    Biochemicals
    Secondary antibodies
    Isotype/Loading Controls
    Antibody Arrays
  • About us
  • Partners
  • Contact
    Address

    Saryarka 32, 18, 010000, Astana city, Kazakhstan

    Telephone +7 771 977 66 65, +7 705 421 2277

    Email

    laboratory@ctlab.kz, orders@abiomed.kz

Back to category
Neuroscience Neurology process Growth and Development Neurotrophins

Recombinant Human BDNF protein (ab151895)

Key features and details

  • Expression system: Escherichia coli
  • Purity: > 95% SDS-PAGE
  • Endotoxin level:
  • Suitable for: HPLC, SDS-PAGE

You may also be interested in

Product image
Human TrkB ELISA Kit (ab264625)
Product image
Anti-p75 NGF Receptor antibody [NORI138B] (ab271289)
Product image
Mouse CDNF Antibody Pair - BSA and Azide free (ab253615)
Product image
Anti-Midkine antibody - BSA and Azide free (Detector) (ab259450)

Description

  • Product name

    Recombinant Human BDNF protein
    See all BDNF proteins and peptides
  • Purity

    > 95 % SDS-PAGE.
    ab151895 is greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. Lyophilized from a 0.2 µM filtered solution.
  • Endotoxin level

  • Expression system

    Escherichia coli
  • Accession

    P23560
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MHSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQL KQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIG WRFIRIDTSCVCTLTIKRGR
    • Predicted molecular weight

      27 kDa
    • Amino acids

      129 to 247
  • Associated products

      Specifications

      Our Abpromise guarantee covers the use of ab151895 in the following tested applications.

      The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

      • Applications

        HPLC

        SDS-PAGE

      • Form

        Lyophilized
      • Concentration information loading...

      Preparation and Storage

      • Stability and Storage

        Shipped at 4°C. Store at -80°C.

        pH: 7.20
        Constituents: 98% Phosphate Buffer, 1.46% Sodium chloride

      • Reconstitution
        Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.

      General Info

      • Alternative names

        • Abrineurin
        • ANON2
        • BDNF
        • BDNF_HUMAN
        • Brain Derived Neurotrophic Factor
        • Brain-derived neurotrophic factor
        • BULN2
        • MGC34632
        • Neurotrophin
        see all
      • Function

        During development, promotes the survival and differentiation of selected neuronal populations of the peripheral and central nervous systems. Participates in axonal growth, pathfinding and in the modulation of dendritic growth and morphology. Major regulator of synaptic transmission and plasticity at adult synapses in many regions of the CNS. The versatility of BDNF is emphasized by its contribution to a range of adaptive neuronal responses including long-term potentiation (LTP), long-term depression (LTD), certain forms of short-term synaptic plasticity, as well as homeostatic regulation of intrinsic neuronal excitability.
      • Tissue specificity

        Brain. Highly expressed in hippocampus, amygdala, cerebral cortex and cerebellum. Also expressed in heart, lung, skeletal muscle, testis, prostate and placenta.
      • Involvement in disease

        Bulimia nervosa 2
        Congenital central hypoventilation syndrome
      • Sequence similarities

        Belongs to the NGF-beta family.
      • Post-translational
        modifications

        The propeptide is N-glycosylated and glycosulfated.
        Converted into mature BDNF by plasmin (PLG).
      • Cellular localization

        Secreted.
      • Target information above from: UniProt accession P23560 The UniProt Consortium
        The Universal Protein Resource (UniProt) in 2010
        Nucleic Acids Res. 38:D142-D148 (2010) .

        Information by UniProt

    Protocols

    To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.

    Click here to view the general protocols

    Datasheets and documents

    • Datasheet
  • References (0)

    Publishing research using ab151895? Please let us know so that we can cite the reference in this datasheet.

    ab151895 has not yet been referenced specifically in any publications.

    Preparation and Storage

    • Alternative names

      • Abrineurin
      • ANON2
      • BDNF
      • BDNF_HUMAN
      • Brain Derived Neurotrophic Factor
      • Brain-derived neurotrophic factor
      • BULN2
      • MGC34632
      • Neurotrophin
      see all
    • Function

      During development, promotes the survival and differentiation of selected neuronal populations of the peripheral and central nervous systems. Participates in axonal growth, pathfinding and in the modulation of dendritic growth and morphology. Major regulator of synaptic transmission and plasticity at adult synapses in many regions of the CNS. The versatility of BDNF is emphasized by its contribution to a range of adaptive neuronal responses including long-term potentiation (LTP), long-term depression (LTD), certain forms of short-term synaptic plasticity, as well as homeostatic regulation of intrinsic neuronal excitability.
    • Tissue specificity

      Brain. Highly expressed in hippocampus, amygdala, cerebral cortex and cerebellum. Also expressed in heart, lung, skeletal muscle, testis, prostate and placenta.
    • Involvement in disease

      Bulimia nervosa 2
      Congenital central hypoventilation syndrome
    • Sequence similarities

      Belongs to the NGF-beta family.
    • Post-translational
      modifications

      The propeptide is N-glycosylated and glycosulfated.
      Converted into mature BDNF by plasmin (PLG).
    • Cellular localization

      Secreted.
    • Target information above from: UniProt accession P23560 The UniProt Consortium
      The Universal Protein Resource (UniProt) in 2010
      Nucleic Acids Res. 38:D142-D148 (2010) .

      Information by UniProt

    Images

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Alternative products to Recombinant Human BDNF protein (ab151895)

    •  
    • BDNF peptide (ab199413)

      Applications: BL

    •  
    • Product image

      Recombinant Human/Murine/Rat BDNF protein (Active) (ab9794)

      Applications: CellAct, HPLC, SDS-PAGE, WB

    •  
    • Recombinant human BDNF protein (Animal Free) (ab217473)

      Applications: FuncS, HPLC, SDS-PAGE

    •  
    • Product image

      Recombinant human BDNF protein (Animal Free) (ab222178)

      Applications: FuncS, HPLC, SDS-PAGE

    •  
    • Product image

      Recombinant human BDNF protein (ab206642)

      Applications: FuncS, HPLC, SDS-PAGE

    •  
    • Human BDNF peptide (ab182199)

      Applications: BL

    Clear all

    Recently viewed products

    •  
    • Product image

      Anti-BLBP antibody (ab32423)

    •  
    • Product image

      Anti-HSA Affibody® Molecule (ab31897)

    •  
    • Product image

      GST tag ELISA Kit (ab126581)

    •  
    • Product image

      Recombinant Human CETP protein (ab114408)

    Get resources and offers direct to your inbox Sign up
    © 2021 Astana Biomed Group LLP. All rights reserved.