Recombinant Human BDNF protein (ab151895)
Key features and details
- Expression system: Escherichia coli
- Purity: > 95% SDS-PAGE
- Endotoxin level:
- Suitable for: HPLC, SDS-PAGE
-
Product name
Recombinant Human BDNF protein
See all BDNF proteins and peptides -
Purity
> 95 % SDS-PAGE.
ab151895 is greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. Lyophilized from a 0.2 µM filtered solution. -
Endotoxin level
Expression system
Escherichia coliAccession
Protein length
Full length proteinAnimal free
NoNature
Recombinant-
Species
Human -
Sequence
MHSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQL KQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIG WRFIRIDTSCVCTLTIKRGR -
Predicted molecular weight
27 kDa -
Amino acids
129 to 247
Associated products
Specifications
Our Abpromise guarantee covers the use of ab151895 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
HPLC
SDS-PAGE
-
Form
Lyophilized -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at -80°C.
pH: 7.20
Constituents: 98% Phosphate Buffer, 1.46% Sodium chloride -
ReconstitutionAlways centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
General Info
-
Alternative names
- Abrineurin
- ANON2
- BDNF
see all -
Function
During development, promotes the survival and differentiation of selected neuronal populations of the peripheral and central nervous systems. Participates in axonal growth, pathfinding and in the modulation of dendritic growth and morphology. Major regulator of synaptic transmission and plasticity at adult synapses in many regions of the CNS. The versatility of BDNF is emphasized by its contribution to a range of adaptive neuronal responses including long-term potentiation (LTP), long-term depression (LTD), certain forms of short-term synaptic plasticity, as well as homeostatic regulation of intrinsic neuronal excitability. -
Tissue specificity
Brain. Highly expressed in hippocampus, amygdala, cerebral cortex and cerebellum. Also expressed in heart, lung, skeletal muscle, testis, prostate and placenta. -
Involvement in disease
Bulimia nervosa 2
Congenital central hypoventilation syndrome -
Sequence similarities
Belongs to the NGF-beta family. -
Post-translational
modificationsThe propeptide is N-glycosylated and glycosulfated.
Converted into mature BDNF by plasmin (PLG). -
Cellular localization
Secreted. - Information by UniProt
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab151895 has not yet been referenced specifically in any publications.
Preparation and Storage
-
Alternative names
- Abrineurin
- ANON2
- BDNF
see all -
Function
During development, promotes the survival and differentiation of selected neuronal populations of the peripheral and central nervous systems. Participates in axonal growth, pathfinding and in the modulation of dendritic growth and morphology. Major regulator of synaptic transmission and plasticity at adult synapses in many regions of the CNS. The versatility of BDNF is emphasized by its contribution to a range of adaptive neuronal responses including long-term potentiation (LTP), long-term depression (LTD), certain forms of short-term synaptic plasticity, as well as homeostatic regulation of intrinsic neuronal excitability. -
Tissue specificity
Brain. Highly expressed in hippocampus, amygdala, cerebral cortex and cerebellum. Also expressed in heart, lung, skeletal muscle, testis, prostate and placenta. -
Involvement in disease
Bulimia nervosa 2
Congenital central hypoventilation syndrome -
Sequence similarities
Belongs to the NGF-beta family. -
Post-translational
modificationsThe propeptide is N-glycosylated and glycosulfated.
Converted into mature BDNF by plasmin (PLG). -
Cellular localization
Secreted. - Information by UniProt
