• Product name

  Recombinant Human Apolipoprotein CIII
  See all Apolipoprotein CIII proteins and peptides

• Expression system

  Wheat germ

• Protein length

  Protein fragment

• Animal free

  No

• Nature

  Recombinant

• • Species

    Human

  • Sequence

    SEAEDASLLSFMQGYMKHATKTAKDALSSVQESQVAQQARGWVTDGFSSL KDYWSTVKDKFSEFWDLDPEVRPTSAVAA

  • Amino acids

    21 to 99

  • Tags

    GST tag N-Terminus

• Alternative names

  • APOC3
  • APO C3
  • Apo CIII

  • Apo-CIII
  • APOC 3
  • ApoC III
  • ApoC-III
  • APOC3
  • APOC3_HUMAN
  • ApoCIII
  • Apolipoprotein C III
  • Apolipoprotein C-III
  • Apolipoprotein C3
  • ApolipoproteinCIII
  • MGC150353

  see all

• Function

  Inhibits lipoprotein lipase and hepatic lipase and decreases the uptake of lymph chylomicrons by hepatic cells. This suggests that it delays the catabolism of triglyceride-rich particles.

• Tissue specificity

  Constitutes 50% of the protein fraction of VLDL and 2% of that of HDL. Synthesized predominantly in liver and to a lesser degree in intestine.

• Involvement in disease

  Defects in APOC3 may be a cause of hyperalphalipoproteinemia (HYPALIP) [MIM:143470]. Affected individuals show high levels of alpha-lipoprotein (high density lipoprotein/HDL).

• Sequence similarities

  Belongs to the apolipoprotein C3 family.

• Post-translational
  modifications

  O-linked glycan consists of Gal-GalNAc disaccharide, further modified with up to 3 sialic acid residues. O-glycosylated on Thr-94 with a core 1 or possibly core 8 glycan.

• Cellular localization

  Secreted.

• Target information above from: UniProt accession P02656 The UniProt Consortium
  The Universal Protein Resource (UniProt) in 2010
  Nucleic Acids Res. 38:D142-D148 (2010) .

  Information by UniProt