Pardaxin, Antibacterial, apoptotic and neurotoxic ionophore (ab141838)
Key features and details
- Antibacterial, apoptotic and neurotoxic ionophore
- CAS Number: 67995-63-5
- Purity: > 98%
Soluble in water
- Form / State: Solid
- Source: Pardachirus marmoratus
Overview
-
Product name
Pardaxin, Antibacterial, apoptotic and neurotoxic ionophore -
Description
Antibacterial, apoptotic and neurotoxic ionophore -
Biological description
Antibacterial, apoptotic and neurotoxic ionophore. Forms pores on lipid membranes. Induces caspase-dependent and ROS-mediated apoptosis. Stimulates calcium-independent PLA2 release of arachidonic acid (Asc 916) and eicosanoids. Active in vivo. -
Purity
> 98% -
CAS Number
67995-63-5 -
Chemical structure
Properties
-
Molecular weight
3382.00 -
Molecular formula
C156H250N36O47 -
Sequence
GFFALIPKIISSPLFKTLLSAVGSALSSSGDQE -
PubChem identifier
16143997 -
Storage instructions
Store at -20°C. Store under desiccating conditions. The product can be stored for up to 12 months. -
Solubility overview
Soluble in water
-
Handling
Wherever possible, you should prepare and use solutions on the same day. However, if you need to make up stock solutions in advance, we recommend that you store the solution as aliquots in tightly sealed vials at -20°C. Generally, these will be useable for up to one month. Before use, and prior to opening the vial we recommend that you allow your product to equilibrate to room temperature for at least 1 hour.
Need more advice on solubility, usage and handling? Please visit our frequently asked questions (FAQ) page for more details.
-
SMILES
CCC(C)C(C(=O)NC(C(C)CC)C(=O)NC(CO)C(=O)NC(CO)C(=O)N1CCCC1C(=O)NC(CC(C)C)C(=O)NC(CC2=CC=CC=C2)C(=O)NC(CCCCN)C(=O)NC(C(C)O)C(=O)NC(CC(C)C)C(=O)NC(CC(C)C)C(=O)NC(CO)C(=O)NC(C)C(=O)NC(C(C)C)C(=O)NCC(=O)NC(CO)C(=O)NC(C)C(=O)NC(CC(C)C)C(=O)NC(CO)C(=O)NC(CO)C(=O -
Source
Pardachirus marmoratus
-
Research areas