Glucagon-Like Peptide II (rat), stimulates cell proliferation in GI tract (ab142306)
Key features and details
- Cytoprotective, stimulates cell proliferation in GI tract
- CAS Number: 195262-56-7
- Purity: > 95%
- Form / State: Solid
- Source: Synthetic
Overview
-
Product name
Glucagon-Like Peptide II (rat), stimulates cell proliferation in GI tract -
Description
Cytoprotective, stimulates cell proliferation in GI tract -
Biological description
Cytoprotective, stimulates cell proliferation in GI tract. Inhibits enterocyte apoptosis. Stimulates enteric neuronal differentiation in vitro via mTOR and ERK pathways. Role in gastrointestinal function and anti-inflammatory agent. Active in vitro and in vivo. -
Purity
> 95% -
CAS Number
195262-56-7 -
Chemical structure

Properties
-
Molecular weight
3796.22 -
Molecular formula
C166H256N44O56S -
Sequence
HADGSFSDEMNTILDNLATRDFINWLIQTKITD -
Storage instructions
Store at +4°C. Store under desiccating conditions. The product can be stored for up to 12 months. -
Handling
Wherever possible, you should prepare and use solutions on the same day. However, if you need to make up stock solutions in advance, we recommend that you store the solution as aliquots in tightly sealed vials at -20°C. Generally, these will be useable for up to one week. Before use, and prior to opening the vial we recommend that you allow your product to equilibrate to room temperature for at least 1 hour.
Need more advice on solubility, usage and handling? Please visit our frequently asked questions (FAQ) page for more details.
-
Source
Synthetic
-
Research areas