Call: +7 771 977 66 65, +7 705 421 2277
Sign in or Register
My basket

Astana Biomed Group, an authorized Abcam distributor in Central Asia

Abiomed homepage

  • Categories
    Signal Transduction
    Cancer
    Epigenetics and Nuclear Signaling
    Immunology
    Cell Biology
    Cardiovascular
    Neuroscience
    Tags & Cell Markers
    Kits/ Lysates/ Other
    Developmental Biology
    Microbiology
    Biochemicals
    Secondary antibodies
    Isotype/Loading Controls
    Antibody Arrays
  • About us
  • Partners
  • Contact
    Address

    Saryarka 32, 18, 010000, Astana city, Kazakhstan

    Telephone +7 771 977 66 65, +7 705 421 2277

    Email

    laboratory@ctlab.kz, orders@abiomed.kz

Back to category
Signal Transduction Signaling Pathway G Protein Signaling Small G Proteins Other

Anti-Von Hippel Lindau/VHL antibody [OTI1E1] (ab140989)

Price and availability

271 382 ₸

Availability

Order now and get it on Friday July 23, 2021

Anti-Von Hippel Lindau/VHL antibody [OTI1E1] (ab140989)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)

Key features and details

  • Mouse monoclonal [OTI1E1] to Von Hippel Lindau/VHL
  • Suitable for: WB, IHC-P
  • Reacts with: Human
  • Isotype: IgG2b

You may also be interested in

Product image
Human GC Globulin ELISA Kit (Vitamin D Binding Protein) (ab108853)
Product image
Anti-RBM11 antibody (ab127553)
Product image
Native Human Factor IX/PTC protein (FITC) (ab92599)
Product image
Anti-IL-33 antibody [EPR20417] (ab207737)

Overview

  • Product name

    Anti-Von Hippel Lindau/VHL antibody [OTI1E1]
    See all Von Hippel Lindau/VHL primary antibodies
  • Description

    Mouse monoclonal [OTI1E1] to Von Hippel Lindau/VHL
  • Host species

    Mouse
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant full length protein corresponding to Human Von Hippel Lindau/VHL aa 1-213. Produced in HEK-293T cells (NP_000542).
    Sequence:

    MPRRAENWDEAEVGAEEAGVEEYGPEEDGGEESGAEESGPEESGPEELGA EEEMEAGRPRPVLRSVNSREPSQVIFCNRSPRVVLPVWLNFDGEPQPYPT LPPGTGRRIHSYRGHLWLFRDAGTHDGLLVNQTELFVPSLNVDGQPIFAN ITLPVYTLKERCLQVVRSLVKPENYRRLDIVRSLYEDLEDHPNVQKDLER LTQERIAHQRMGD


    Database link: P40337
    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
  • Positive control

    • WB: Recombinant Human Von Hippel Lindau/VHL protein (ab82240), HEK-293T cell lysate transfected with pCMV6-ENTRY Von Hippel Lindau/VHL cDNA. IHC-P: Human colon carcinoma, ovary adenocarcinoma, pancreas, endometrium adenocarcinoma, lung carcinoma, endometrium and bladder tissue.
  • General notes

    Clone OTI1E1 (formerly 1E1).

    The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.

    If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.30
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 1% BSA, 50% Glycerol
  • Concentration information loading...
  • Purity

    Affinity purified
  • Purification notes

    Purified from cell culture supernatant.
  • Clonality

    Monoclonal
  • Clone number

    OTI1E1
  • Isotype

    IgG2b
  • Research areas

    • Cell Biology
    • Cell Cycle
    • Cell Cycle Inhibitors
    • Other
    • Cell Biology
    • Proteolysis / Ubiquitin
    • Proteasome / Ubiquitin
    • Proteasome
    • Cell Biology
    • Proteolysis / Ubiquitin
    • Proteasome / Ubiquitin
    • Ubiquitin
    • Cell Biology
    • Cell Cycle
    • Cell differentiation
    • Epigenetics and Nuclear Signaling
    • Transcription
    • Polymerase associated factors
    • Pol II Transcription
    • Other
    • Epigenetics and Nuclear Signaling
    • Transcription
    • Co-factors
    • Cancer
    • Cell cycle
    • Cell differentiation
    • Cancer
    • Oncoproteins/suppressors
    • Tumor suppressors
    • Other
    • Cancer
    • Cancer Metabolism
    • Response to hypoxia
    • Metabolism
    • Pathways and Processes
    • Cofactors, Vitamins / minerals
    • Co-factors
    • Metabolism
    • Pathways and Processes
    • Metabolism processes
    • Hypoxia

Images

  • Western blot - Anti-Von Hippel Lindau/VHL antibody [OTI1E1] (ab140989)
    Western blot - Anti-Von Hippel Lindau/VHL antibody [OTI1E1] (ab140989)
    All lanes : Anti-Von Hippel Lindau/VHL antibody [OTI1E1] (ab140989) at 1/4000 dilution

    Lane 1 : HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) cell lysate transfected with pCMV6-ENTRY control cDNA
    Lane 2 : HEK-293T cell lysate transfected with pCMV6-ENTRY Von Hippel Lindau cDNA

    Lysates/proteins at 5 µg per lane.

    Predicted band size: 24 kDa

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Von Hippel Lindau/VHL antibody [OTI1E1] (ab140989)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Von Hippel Lindau/VHL antibody [OTI1E1] (ab140989)

    Paraffin-embedded human colon adenocarcinoma tissue stained for Von Hippel Lindau/VHL using ab140989 at 1/150 dilution in immunohistochemical analysis.

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Von Hippel Lindau/VHL antibody [OTI1E1] (ab140989)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Von Hippel Lindau/VHL antibody [OTI1E1] (ab140989)

    Paraffin-embedded human lung carcinoma tissue stained for Von Hippel Lindau/VHL using ab140989 at 1/150 dilution in immunohistochemical analysis.

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Von Hippel Lindau/VHL antibody [OTI1E1] (ab140989)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Von Hippel Lindau/VHL antibody [OTI1E1] (ab140989)

    Paraffin-embedded human ovary adenocarcinoma tissue stained for Von Hippel Lindau/VHL using ab140989 at 1/150 dilution in immunohistochemical analysis.

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Von Hippel Lindau/VHL antibody [OTI1E1] (ab140989)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Von Hippel Lindau/VHL antibody [OTI1E1] (ab140989)

    Paraffin-embedded human pancreas tissue stained for Von Hippel Lindau/VHL using ab140989 at 1/150 dilution in immunohistochemical analysis.

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Von Hippel Lindau/VHL antibody [OTI1E1] (ab140989)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Von Hippel Lindau/VHL antibody [OTI1E1] (ab140989)

    Paraffin-embedded human endometrium tissue stained for Von Hippel Lindau/VHL using ab140989 at 1/150 dilution in immunohistochemical analysis.

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Von Hippel Lindau/VHL antibody [OTI1E1] (ab140989)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Von Hippel Lindau/VHL antibody [OTI1E1] (ab140989)

    Paraffin-embedded human endometrium adenocarcinoma tissue stained for Von Hippel Lindau/VHL using ab140989 at 1/150 dilution in immunohistochemical analysis.

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Von Hippel Lindau/VHL antibody [OTI1E1] (ab140989)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Von Hippel Lindau/VHL antibody [OTI1E1] (ab140989)

    Paraffin-embedded human bladder tissue stained for Von Hippel Lindau/VHL using ab140989 at 1/150 dilution in immunohistochemical analysis.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Alternative products to Anti-Von Hippel Lindau/VHL antibody [OTI1E1] (ab140989)

  •  
  • Product image

    Anti-Von Hippel Lindau/VHL antibody (ab77262)

    Applications: WB

  •  
  • Product image

    Anti-Von Hippel Lindau/VHL antibody (ab83307)

    Applications: WB

  •  
  • Product image

    Anti-Von Hippel Lindau/VHL antibody (ab244444)

    Applications: ICC/IF

  •  
  • Anti-Von Hippel Lindau/VHL antibody (ab28434)

    Applications:

  •  
  • Product image

    Anti-Von Hippel Lindau/VHL antibody (ab244445)

    Applications: ICC/IF

Clear all

Recently viewed products

  •  
  • Anti-MAdCAM1 antibody [MECA-367] - Low endotoxin, Azide free (ab185781)

Get resources and offers direct to your inbox Sign up
© 2021 Astana Biomed Group LLP. All rights reserved.