Anti-Von Hippel Lindau/VHL antibody [OTI1E1] (ab140989)
Key features and details
- Mouse monoclonal [OTI1E1] to Von Hippel Lindau/VHL
- Suitable for: WB, IHC-P
- Reacts with: Human
- Isotype: IgG2b
Overview
-
Product name
Anti-Von Hippel Lindau/VHL antibody [OTI1E1]
See all Von Hippel Lindau/VHL primary antibodies -
Description
Mouse monoclonal [OTI1E1] to Von Hippel Lindau/VHL -
Host species
Mouse -
Tested applications
Suitable for: WB, IHC-Pmore details -
Species reactivity
Reacts with: Human -
Immunogen
Recombinant full length protein corresponding to Human Von Hippel Lindau/VHL aa 1-213. Produced in HEK-293T cells (NP_000542).
Sequence:MPRRAENWDEAEVGAEEAGVEEYGPEEDGGEESGAEESGPEESGPEELGA EEEMEAGRPRPVLRSVNSREPSQVIFCNRSPRVVLPVWLNFDGEPQPYPT LPPGTGRRIHSYRGHLWLFRDAGTHDGLLVNQTELFVPSLNVDGQPIFAN ITLPVYTLKERCLQVVRSLVKPENYRRLDIVRSLYEDLEDHPNVQKDLER LTQERIAHQRMGD
Database link: P40337 -
Positive control
- WB: Recombinant Human Von Hippel Lindau/VHL protein (ab82240), HEK-293T cell lysate transfected with pCMV6-ENTRY Von Hippel Lindau/VHL cDNA. IHC-P: Human colon carcinoma, ovary adenocarcinoma, pancreas, endometrium adenocarcinoma, lung carcinoma, endometrium and bladder tissue.
-
General notes
Clone OTI1E1 (formerly 1E1).
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.
If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.30
Preservative: 0.02% Sodium azide
Constituents: PBS, 1% BSA, 50% Glycerol -
Concentration information loading...
-
Purity
Affinity purified -
Purification notes
Purified from cell culture supernatant. -
Clonality
Monoclonal -
Clone number
OTI1E1 -
Isotype
IgG2b -
Research areas
Images
-
All lanes : Anti-Von Hippel Lindau/VHL antibody [OTI1E1] (ab140989) at 1/4000 dilution
Lane 1 : HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) cell lysate transfected with pCMV6-ENTRY control cDNA
Lane 2 : HEK-293T cell lysate transfected with pCMV6-ENTRY Von Hippel Lindau cDNA
Lysates/proteins at 5 µg per lane.
Predicted band size: 24 kDa
-
Paraffin-embedded human colon adenocarcinoma tissue stained for Von Hippel Lindau/VHL using ab140989 at 1/150 dilution in immunohistochemical analysis.
-
Paraffin-embedded human lung carcinoma tissue stained for Von Hippel Lindau/VHL using ab140989 at 1/150 dilution in immunohistochemical analysis.
-
Paraffin-embedded human ovary adenocarcinoma tissue stained for Von Hippel Lindau/VHL using ab140989 at 1/150 dilution in immunohistochemical analysis.
-
Paraffin-embedded human pancreas tissue stained for Von Hippel Lindau/VHL using ab140989 at 1/150 dilution in immunohistochemical analysis.
-
Paraffin-embedded human endometrium tissue stained for Von Hippel Lindau/VHL using ab140989 at 1/150 dilution in immunohistochemical analysis.
-
Paraffin-embedded human endometrium adenocarcinoma tissue stained for Von Hippel Lindau/VHL using ab140989 at 1/150 dilution in immunohistochemical analysis.
-
Paraffin-embedded human bladder tissue stained for Von Hippel Lindau/VHL using ab140989 at 1/150 dilution in immunohistochemical analysis.