Call: +7 771 977 66 65, +7 705 421 2277
Sign in or Register
My basket

Astana Biomed Group, an authorized Abcam distributor in Central Asia

Abiomed homepage

  • Categories
    Signal Transduction
    Cancer
    Epigenetics and Nuclear Signaling
    Immunology
    Cell Biology
    Cardiovascular
    Neuroscience
    Tags & Cell Markers
    Kits/ Lysates/ Other
    Developmental Biology
    Microbiology
    Biochemicals
    Secondary antibodies
    Isotype/Loading Controls
    Antibody Arrays
  • About us
  • Partners
  • Contact
    Address

    Saryarka 32, 18, 010000, Astana city, Kazakhstan

    Telephone +7 771 977 66 65, +7 705 421 2277

    Email

    laboratory@ctlab.kz, orders@abiomed.kz

Back to category

Anti-TMS1/ASC antibody (ab180799)

Price and availability

291 484 ₸

Availability

Order now and get it on Wednesday February 24, 2021

Anti-TMS1/ASC antibody (ab180799)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)

Key features and details

  • Rabbit polyclonal to TMS1/ASC
  • Suitable for: ICC/IF, IHC-P, WB
  • Reacts with: Rat, Human
  • Isotype: IgG

You may also be interested in

Product image
Anti-Cannabinoid Receptor I (phospho S316) antibody [EPR2223(N)] (ab186428)
Product image
PE Anti-CD44 antibody [KM201] (ab25224)
Product image
Recombinant human PD-L1 protein (Active) (ab271707)
Product image
Anti-TL1A antibody (ab85566)

Overview

  • Product name

    Anti-TMS1/ASC antibody
    See all TMS1/ASC primary antibodies
  • Description

    Rabbit polyclonal to TMS1/ASC
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, IHC-P, WBmore details
  • Species reactivity

    Reacts with: Rat, Human
  • Immunogen

    Recombinant full length protein corresponding to Human TMS1/ASC aa 1-195.
    Sequence:

    MGRARDAILDALENLTAEELKKFKLKLLSVPLREGYGRIPRGALLSMDAL DLTDKLVSFYLETYGAELTANVLRDMGLQEMAGQLQAATHQGSGAAPAGI QAPPQSAAKPGLHFIDQHRAALIARVTNVEWLLDALYGKVLTDEQYQAVR AEPTNPSKMRKLFSFTPAWNWTCKDLLLQA LRESQSYLVEDLERS


    Database link: Q9ULZ3
    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
  • Positive control

    • A549, THP1, HT29 and BT474 cell line extracts.
  • General notes

     This product was previously labelled as TMS1

     

    Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.

    Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.

    We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.

    In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.

    We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.

    Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.

    Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.30
    Preservative: 0.02% Sodium azide
    Constituents: 50% Glycerol, 49% PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

    • Cell Biology
    • Apoptosis
    • Intracellular
    • Associated Proteins
    • Cell Biology
    • Apoptosis
    • Intracellular
    • Caspases etc
    • CARD Family
    • Cancer
    • Tumor biomarkers
    • Other

Images

  • Western blot - Anti-TMS1/ASC antibody (ab180799)
    Western blot - Anti-TMS1/ASC antibody (ab180799)
    All lanes : Anti-TMS1/ASC antibody (ab180799) at 1/500 dilution

    Lane 1 : A549 cell line extract
    Lane 2 : THP1 cell line extract
    Lane 3 : HT29 cell line extract
    Lane 4 : BT474 cell line extract

    Predicted band size: 22 kDa

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-TMS1/ASC antibody (ab180799)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-TMS1/ASC antibody (ab180799)

    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of rat spleen tissue labelling TMS1/ASC with ab180799 at 1/200. Magnification: 400x.

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-TMS1/ASC antibody (ab180799)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-TMS1/ASC antibody (ab180799)

    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human kidney tissue labelling TMS1/ASC with ab180799 at 1/200. Magnification: 200x.

  • Immunocytochemistry/ Immunofluorescence - Anti-TMS1/ASC antibody (ab180799)
    Immunocytochemistry/ Immunofluorescence - Anti-TMS1/ASC antibody (ab180799)
    Immunocytochemistry/Immunofluorescence analysis of HeLa cells using ab180799. Blue DAPI for nuclear staining.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Alternative products to Anti-TMS1/ASC antibody (ab180799)

  •  
  • Product image

    Anti-TMS1/ASC antibody (ab175449)

    Applications: ICC

  •  
  • Product image

    Biotin Anti-TMS1/ASC antibody - C-terminal (ab240495)

    Applications: WB

  •  
  • Product image

    Anti-TMS1/ASC antibody [EPR10403] (ab155970)

    Applications: Flow Cyt, ICC/IF, WB

  •  
  • Product image

    Anti-TMS1/ASC antibody (ab111852)

    Applications: IHC-P, WB

  •  
  • Product image

    Anti-TMS1/ASC antibody (ab227502)

    Applications: ICC/IF, WB

  •  
  • Product image

    Anti-TMS1/ASC antibody [EPR10403] - BSA and Azide free (ab242398)

    Applications: Flow Cyt, ICC/IF, WB

  •  
  • Product image

    Anti-TMS1/ASC antibody [EPR10402(B)] (ab151700)

    Applications: IP, WB

  •  
  • Product image

    Anti-TMS1/ASC antibody (ab2236)

    Applications: IHC-P, WB

Clear all

Recently viewed products

  •  
  • Anti-BCRP/ABCG2 antibody [BXP-21] (ab3380)

  •  
  • Product image

    Anti-SLC6A14 antibody (ab254786)

  •  
  • Product image

    Human E2F4 knockout HEK-293T cell line (ab266119)

  •  
  • Product image

    Recombinant Human PIH1D1 protein (denatured) (ab176047)

  •  
  • COMP/Cartilage oligomeric matrix protein - Blocking Peptide (ab275078)

Get resources and offers direct to your inbox Sign up
© 2021 Astana Biomed Group LLP. All rights reserved.