Anti-TMPRSS5 antibody [OTI4G4] (ab139163)
![Anti-TMPRSS5 antibody [OTI4G4] (ab139163)](https://www.abcam.com/ps/products/139/ab139163/Images/ab139163-154359-anti-tmprss5-antibody-oti4g4-immunohistochemistry.jpg "Anti-TMPRSS5 antibody [OTI4G4] (ab139163)")
Key features and details
- Mouse monoclonal [OTI4G4] to TMPRSS5
- Suitable for: WB, IHC-P, ICC/IF
- Reacts with: Human, African green monkey
- Isotype: IgG1
Overview
-
Product name
Anti-TMPRSS5 antibody [OTI4G4]
See all TMPRSS5 primary antibodies -
Description
Mouse monoclonal [OTI4G4] to TMPRSS5 -
Host species
Mouse -
Tested applications
Suitable for: WB, IHC-P, ICC/IFmore details -
Species reactivity
Reacts with: Human, African green monkey -
Immunogen
Recombinant full length protein corresponding to Human TMPRSS5 aa 1-457. Produced in HEK-293T cells (NP_110397).
Sequence:MSLMLDDQPPMEAQYAEEGPGPGIFRAEPGDQQHPISQAVCWRSMRRGCA VLGALGLLAGAGVGSWLLVLYLCPAASQPISGTLQDEEITLSCSEASAEE ALLPALPKTVSFRINSEDFLLEAQVRDQPRWLLVCHEGWSPALGLQICWS LGHLRLTHHKGVNLTDIKLNSSQEFAQLSPRLGGFLEEAWQPRNNCTSGQ VVSLRCSECGARPLASRIVGGQSVAPGRWPWQASVALGFRHTCGGSVLAP RWVVTAAHCMHSFRLARLSSWRVHAGLVSHSAVRPHQGALVERIIPHPLY SAQNHDYDVALLRLQTALNFSDTVGAVCLPAKEQHFPKGSRCWVSGWGHT HPSHTYSSDMLQDTVVPLFSTQLCNSSCVYSGALTPRMLCAGYLDGRADA CQGDSGGPLVCPDGDTWRLVGVVSWGRGCAEPNHPGVYAKVAEFLDWIHD TAQDSLL
Database link: Q9H3S3 -
Positive control
- WB: HEK-293T cells transfected with pCMV6-ENTRY TMPRSS5 cDNA. IHC-P: Human prostate tissue. ICC/IF: COS-7 cells transiently transfected with pCMV6-ENTRY TMPRSS5.
-
General notes
Clone OTI4G4 (formerly 4G4).
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.
If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.30
Preservative: 0.02% Sodium azide
Constituents: PBS, 50% Glycerol, 1% BSA -
Concentration information loading... -
Purity
Affinity purified -
Purification notes
Purified from cell culture supernatant by affinity chromatography. -
Clonality
Monoclonal -
Clone number
OTI4G4 -
Isotype
IgG1 -
Research areas
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-TMPRSS5 antibody [OTI4G4] (ab139163)
Paraffin-embedded human prostate tissue stained for TMPRSS5 with ab139163 at a 1/150 dilution in immunohistochemical analysis. Heat-induced epitope retrieval by 10 mM citric buffer, pH6.0, 120°C for 3 minutes.
-
![Western blot - Anti-TMPRSS5 antibody [OTI4G4] (ab139163)](https://www.abcam.com/ps/products/139/ab139163/Images/ab139163-154360-anti-tmprss5-antibody-oti4g4-western-blot.jpg)
Western blot - Anti-TMPRSS5 antibody [OTI4G4] (ab139163)All lanes : Anti-TMPRSS5 antibody [OTI4G4] (ab139163) at 1/1000 dilution
Lane 1 : HEK-293T (Human epithelial cell line from embryonic kidney transformed with large T antigen) cell lysate transfected with pCMV6-ENTRY control cDNA
Lane 2 : HEK-293T cell lysate transfected with pCMV6-ENTRY TMPRSS5 cDNA
Lysates/proteins at 5 µg per lane.
Predicted band size: 50 kDa
-
![Immunocytochemistry/ Immunofluorescence - Anti-TMPRSS5 antibody [OTI4G4] (ab139163)](https://www.abcam.com/ps/products/139/ab139163/Images/ab139163-154358-anti-tmprss5-antibody-oti4g4-immunofluorescence.jpg)
Immunocytochemistry/ Immunofluorescence - Anti-TMPRSS5 antibody [OTI4G4] (ab139163)pCMV6-ENTRY TMPRSS5 cDNA transfected COS-7 (African green monkey kidney fibroblast-like cell line) cells stained for TMPRSS5 using ab139163 at a 1/100 dilution in ICC/IF.
