Anti-Tartrate Resistant Acid Phosphatase antibody [7E6A11] (ab181468)
Key features and details
- Mouse monoclonal [7E6A11] to Tartrate Resistant Acid Phosphatase
- Suitable for: IHC-P, WB
- Reacts with: Human, Recombinant fragment
- Isotype: IgG1
Overview
-
Product name
Anti-Tartrate Resistant Acid Phosphatase antibody [7E6A11]
See all Tartrate Resistant Acid Phosphatase primary antibodies -
Description
Mouse monoclonal [7E6A11] to Tartrate Resistant Acid Phosphatase -
Host species
Mouse -
Tested applications
Suitable for: IHC-P, WBmore details -
Species reactivity
Reacts with: Human, Recombinant fragment
Predicted to work with: Mouse, Rat
-
Immunogen
Recombinant fragment corresponding to Human Tartrate Resistant Acid Phosphatase aa 221-325. (Expressed in E.coli).
Sequence:VKQLRPLLATYGVTAYLCGHDHNLQYLQDENGVGYVLSGAGNFMDPSKRH QRKVPNGYLRFHYGTEDSLGGFAYVEISSKEMTVTYIEASGKSLFKTRLP RRARP
Database link: P13686 -
Positive control
- T47D, HepG2, MOLT4, Jurkat and Hela cell lysates; Human TRAP 5 recombinant protein; TRAP 5 (aa 221-325)-hIgGFc transfected HEK293 cell lysate; Human liver cancer tissue.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
Preservative: 0.05% Sodium azide
Constituent: 99% PBS
Contains 0.5% protein stabilizer -
Concentration information loading... -
Purity
Protein G purified -
Purification notes
Purified from tissue culture supernatant. -
Clonality
Monoclonal -
Clone number
7E6A11 -
Isotype
IgG1 -
Research areas
Images
-
All lanes : Anti-Tartrate Resistant Acid Phosphatase antibody [7E6A11] (ab181468) at 1/500 dilution
Lane 1 : A431 cell lysate
Lane 2 : T47D cell lysate
Lane 3 : HepG2 cell lysate
Lane 4 : MOLT4 cell lysate
Lane 5 : Jurkat cell lysate
Lane 6 : Hela cell lysate
Predicted band size: 37 kDa
-
All lanes : Anti-Tartrate Resistant Acid Phosphatase antibody [7E6A11] (ab181468) at 1/500 dilution
Lane 1 : Non-transfected HEK293 cell lysate
Lane 2 : TRAP 5 (aa 221-325)-hIgGFc transfected HEK293 cell lysate
Predicted band size: 37 kDa
-
Anti-Tartrate Resistant Acid Phosphatase antibody [7E6A11] (ab181468) at 1/500 dilution + TRAP 5 recombinant protein
Predicted band size: 37 kDaExpected MWt is 37.3 kDa.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Tartrate Resistant Acid Phosphatase antibody [7E6A11] (ab181468)Immunohistochemical analysis of paraffin-embedded Human liver cancer tissue labeling Tartrate Resistant Acid Phosphatase with ab181468 at 1/200 dilution with DAB staining.

