Call: +7 771 977 66 65, +7 705 421 2277
Sign in or Register
My basket

Astana Biomed Group, an authorized Abcam distributor in Central Asia

Abiomed homepage

  • Categories
    Signal Transduction
    Cancer
    Epigenetics and Nuclear Signaling
    Immunology
    Cell Biology
    Cardiovascular
    Neuroscience
    Tags & Cell Markers
    Kits/ Lysates/ Other
    Developmental Biology
    Microbiology
    Biochemicals
    Secondary antibodies
    Isotype/Loading Controls
    Antibody Arrays
  • About us
  • Partners
  • Contact
    Address

    Saryarka 32, 18, 010000, Astana city, Kazakhstan

    Telephone +7 771 977 66 65, +7 705 421 2277

    Email

    laboratory@ctlab.kz, orders@abiomed.kz

Back to category
Immunology Innate Immunity Macrophage / Inflamm.

Anti-Tartrate Resistant Acid Phosphatase antibody [7E6A11] (ab181468)

Anti-Tartrate Resistant Acid Phosphatase antibody [7E6A11] (ab181468)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)

Key features and details

  • Mouse monoclonal [7E6A11] to Tartrate Resistant Acid Phosphatase
  • Suitable for: IHC-P, WB
  • Reacts with: Human, Recombinant fragment
  • Isotype: IgG1

You may also be interested in

Product image
Anti-TLT-1 antibody - BSA and Azide free (Detector) (ab242792)
Recombinant Human TIL/TLR1 protein (ab157264)
Product image
Mouse Myeloperoxidase ELISA Kit (MPO)  (ab275109)
Product image
Recombinant Human IFN-alpha-7 protein (denatured) (ab139213)

Overview

  • Product name

    Anti-Tartrate Resistant Acid Phosphatase antibody [7E6A11]
    See all Tartrate Resistant Acid Phosphatase primary antibodies
  • Description

    Mouse monoclonal [7E6A11] to Tartrate Resistant Acid Phosphatase
  • Host species

    Mouse
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human, Recombinant fragment
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment corresponding to Human Tartrate Resistant Acid Phosphatase aa 221-325. (Expressed in E.coli).
    Sequence:

    VKQLRPLLATYGVTAYLCGHDHNLQYLQDENGVGYVLSGAGNFMDPSKRH QRKVPNGYLRFHYGTEDSLGGFAYVEISSKEMTVTYIEASGKSLFKTRLP RRARP


    Database link: P13686
    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
  • Positive control

    • T47D, HepG2, MOLT4, Jurkat and Hela cell lysates; Human TRAP 5 recombinant protein; TRAP 5 (aa 221-325)-hIgGFc transfected HEK293 cell lysate; Human liver cancer tissue.
  • General notes

    Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.

    Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.

    We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.

    In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.

    We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.

    Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.

    Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.05% Sodium azide
    Constituent: 99% PBS

    Contains 0.5% protein stabilizer
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purified from tissue culture supernatant.
  • Clonality

    Monoclonal
  • Clone number

    7E6A11
  • Isotype

    IgG1
  • Research areas

    • Immunology
    • Innate Immunity
    • Macrophage / Inflamm.
    • Signal Transduction
    • Protein Trafficking
    • Organelle Proteins
    • Signal Transduction
    • Cytoskeleton / ECM
    • Extracellular Matrix
    • Structures
    • Bone
    • Signal Transduction
    • Metabolism
    • Vitamins / Minerals
    • Metabolism
    • Pathways and Processes
    • Cofactors, Vitamins / minerals
    • Vitamins / minerals

Images

  • Western blot - Anti-Tartrate Resistant Acid Phosphatase antibody [7E6A11] (ab181468)
    Western blot - Anti-Tartrate Resistant Acid Phosphatase antibody [7E6A11] (ab181468)
    All lanes : Anti-Tartrate Resistant Acid Phosphatase antibody [7E6A11] (ab181468) at 1/500 dilution

    Lane 1 : A431 cell lysate
    Lane 2 : T47D cell lysate
    Lane 3 : HepG2 cell lysate
    Lane 4 : MOLT4 cell lysate
    Lane 5 : Jurkat cell lysate
    Lane 6 : Hela cell lysate

    Predicted band size: 37 kDa

  • Western blot - Anti-Tartrate Resistant Acid Phosphatase antibody [7E6A11] (ab181468)
    Western blot - Anti-Tartrate Resistant Acid Phosphatase antibody [7E6A11] (ab181468)
    All lanes : Anti-Tartrate Resistant Acid Phosphatase antibody [7E6A11] (ab181468) at 1/500 dilution

    Lane 1 : Non-transfected HEK293 cell lysate
    Lane 2 : TRAP 5 (aa 221-325)-hIgGFc transfected HEK293 cell lysate

    Predicted band size: 37 kDa

  • Western blot - Anti-Tartrate Resistant Acid Phosphatase antibody [7E6A11] (ab181468)
    Western blot - Anti-Tartrate Resistant Acid Phosphatase antibody [7E6A11] (ab181468)
    Anti-Tartrate Resistant Acid Phosphatase antibody [7E6A11] (ab181468) at 1/500 dilution + TRAP 5 recombinant protein

    Predicted band size: 37 kDa



    Expected MWt is 37.3 kDa.

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Tartrate Resistant Acid Phosphatase antibody [7E6A11] (ab181468)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Tartrate Resistant Acid Phosphatase antibody [7E6A11] (ab181468)

    Immunohistochemical analysis of paraffin-embedded Human liver cancer tissue labeling Tartrate Resistant Acid Phosphatase with ab181468 at 1/200 dilution with DAB staining.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Alternative products to Anti-Tartrate Resistant Acid Phosphatase antibody [7E6A11] (ab181468)

  •  
  • Product image

    Anti-Tartrate Resistant Acid Phosphatase antibody [EPR15556] - BSA and Azide free (ab240970)

    Applications: ICC/IF, IHC-P, IP, WB

  •  
  • Product image

    Anti-Tartrate Resistant Acid Phosphatase antibody (ab185716)

    Applications: ICC/IF, WB

  •  
  • Product image

    Anti-Tartrate Resistant Acid Phosphatase antibody [ACP5/1070] - BSA and Azide free (ab212723)

    Applications: IHC-P

  •  
  • Product image

    Anti-Tartrate Resistant Acid Phosphatase antibody [EPR15556] (ab191406)

    Applications: ICC/IF, IHC-P, IP, WB

  •  
  • Product image

    Alexa Fluor® 488 Anti-Tartrate Resistant Acid Phosphatase antibody [EPR15556] (ab216934)

    Applications: ICC/IF

  •  
  • Product image

    Anti-Tartrate Resistant Acid Phosphatase antibody [rACP5/1070] - BSA and Azide free (ab237879)

    Applications: IHC-P, Protein Array

  •  
  • Product image

    Anti-Tartrate Resistant Acid Phosphatase antibody [rACP5/1070] (ab238033)

    Applications: IHC-P, Protein Array

Clear all

Recently viewed products

  •  
  • Product image

    Anti-Ubiquitin (linkage-specific K63) antibody [EPR8590-448] (ab179434)

  •  
  • Product image

    Anti-uPA Receptor/U-PAR antibody [EPR22814-273] (ab255815)

  •  
  • Product image

    Anti-RUNX1 / AML1 + RUNX3 + RUNX2 antibody [EPR3099] - BSA and Azide free (ab220117)

  •  
  • Product image

    Anti-PAK1 antibody [EPR20048] - BSA and Azide free (ab242421)

  •  
  • Product image

    Anti-MARCO antibody [EPR22944-64] - BSA and Azide free (ab256822)

  •  
  • Product image

    Anti-Hemoglobin subunit alpha antibody [EPR3608] - BSA and Azide free (ab174536)

Get resources and offers direct to your inbox Sign up
© 2021 Astana Biomed Group LLP. All rights reserved.