Call: +7 771 977 66 65, +7 705 421 2277
Sign in or Register
My basket

Astana Biomed Group, an authorized Abcam distributor in Central Asia

Abiomed homepage

  • Categories
    Signal Transduction
    Cancer
    Epigenetics and Nuclear Signaling
    Immunology
    Cell Biology
    Cardiovascular
    Neuroscience
    Tags & Cell Markers
    Kits/ Lysates/ Other
    Developmental Biology
    Microbiology
    Biochemicals
    Secondary antibodies
    Isotype/Loading Controls
    Antibody Arrays
  • About us
  • Partners
  • Contact
    Address

    Saryarka 32, 18, 010000, Astana city, Kazakhstan

    Telephone +7 771 977 66 65, +7 705 421 2277

    Email

    laboratory@ctlab.kz, orders@abiomed.kz

Back to category
Immunology Innate Immunity Macrophage / Inflamm.

Recombinant rat CCL4/MIP-1 beta protein (ab201370)

Key features and details

  • Expression system: Escherichia coli
  • Purity: > 95% SDS-PAGE
  • Active: Yes
  • Suitable for: Functional Studies, HPLC, SDS-PAGE

You may also be interested in

Recombinant Mouse M-CSF protein (His tag) (ab215579)
Product image
Recombinant Human TLR6 protein (ab153069)
Product image
Anti-NLRP7 antibody (ab117732)
Anti-NLRP3 antibody - BSA and Azide free (Detector) (ab277265)

Description

  • Product name

    Recombinant rat CCL4/MIP-1 beta protein
    See all CCL4/MIP-1 beta proteins and peptides
  • Biological activity

    Fully biologically active when compared to standard.

    The biological activity determined by a chemotaxis bioassay using Human peripheral blood monocytes is in a concentration range of 10-1000 ng/ml.

  • Purity

    > 95 % SDS-PAGE.
    >95% by HPLC analysis.
  • Expression system

    Escherichia coli
  • Accession

    P50230
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Rat
    • Sequence

      APIGSDPPTSCCFSYTSRKIHRNFVMDYYETSSLCSQPAVVFLTKKGRQI CADPSEPWVNEYVNDLELN
    • Predicted molecular weight

      8 kDa
    • Amino acids

      24 to 92
    • Additional sequence information

      Single non-glycosylated polypeptide chain. This product is the mature full length protein from aa 24 to 92. The signal peptide is not included.

Preparation and Storage

  • Alternative names

    • MIP 1 beta
    • Secreted protein G 26
    • ACT 2
    • ACT-2
    • ACT2
    • AT744.1
    • AT744.2
    • C C motif chemokine 4
    • C C motif chemokine 4 like
    • C C motif chemokine ligand 4 like 1
    • C C motif chemokine ligand 4 like 2
    • CC chemokine ligand 4
    • CC chemokine ligand 4L1
    • CC chemokine ligand 4L1d2
    • CC chemokine ligand 4L2
    • CCL4
    • CCL4_HUMAN
    • CCL4L
    • ccl4l 1
    • CCL4L1
    • Chemokine (C C motif) ligand 4
    • Chemokine (C C motif) ligand 4 like 1
    • Chemokine (C C motif) ligand 4 like 1, telomeric
    • Chemokine (C C motif) ligand 4 like 2
    • Chemokine CC Motif Ligand 4
    • G 26
    • G 26 T lymphocyte secreted protein
    • G-26 T-lymphocyte-secreted protein
    • HC21
    • Immune activation 2
    • LAG 1
    • LAG-1
    • LAG1
    • Lymphocyte activation gene 1
    • Lymphocyte activation gene 1 protein
    • Macrophage inflammatory protein 1 beta
    • Macrophage inflammatory protein 1-beta
    • Macrophage inflammatory protein 1b2
    • MGC104418
    • MGC126025
    • MGC126026
    • MIP-1-beta
    • MIP-1-beta(1-69)
    • MIP-1-beta(3-69)
    • MIP1 beta
    • MIP1B
    • MIP1B1
    • Monocyte adherence induced protein 5 alpha
    • PAT 744
    • Protein H400
    • SCYA2
    • SCYA4
    • SCYA4L
    • SCYA4L1
    • SCYA4L2
    • SCYQ4L2
    • Secreted protein G 26
    • Secreted protein G26
    • SIS gamma
    • SIS-gamma
    • Small inducible cytokine A4
    • Small inducible cytokine A4 (homologous to mouse Mip 1b)
    • small inducible cytokine A4-like
    • Small-inducible cytokine A4
    • T cell activation protein 2
    • T-cell activation protein 2
    see all
  • Function

    Monokine with inflammatory and chemokinetic properties. Binds to CCR5. One of the major HIV-suppressive factors produced by CD8+ T-cells. Recombinant MIP-1-beta induces a dose-dependent inhibition of different strains of HIV-1, HIV-2, and simian immunodeficiency virus (SIV). The processed form MIP-1-beta(3-69) retains the abilities to induce down-modulation of surface expression of the chemokine receptor CCR5 and to inhibit the CCR5-mediated entry of HIV-1 in T-cells. MIP-1-beta(3-69) is also a ligand for CCR1 and CCR2 isoform B.
  • Sequence similarities

    Belongs to the intercrine beta (chemokine CC) family.
  • Post-translational
    modifications

    N-terminal processed form MIP-1-beta(3-69) is produced by proteolytic cleavage after secretion from peripheral blood lymphocytes.
  • Cellular localization

    Secreted.
  • Target information above from: UniProt accession P13236 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt

Images

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Alternative products to Recombinant rat CCL4/MIP-1 beta protein (ab201370)

  •  
  • Recombinant Sheep CCL4/MIP-1 beta protein (ab208819)

    Applications: SDS-PAGE

  •  
  • Recombinant mouse CCL4/MIP-1 beta protein (ab202810)

    Applications: FuncS, HPLC, SDS-PAGE

  •  
  • Recombinant Cow CCL4/MIP-1 beta protein (ab128558)

    Applications: SDS-PAGE

  •  
  • Recombinant Cow CCL4/MIP-1 beta protein (ab87504)

    Applications: SDS-PAGE

  •  
  • Recombinant Chicken CCL4/MIP-1 beta protein (ab87466)

    Applications: SDS-PAGE

  •  
  • Recombinant Horse CCL4/MIP-1 beta protein (ab203716)

    Applications: ELISA, WB

  •  
  • Recombinant Mouse CCL4/MIP-1 beta protein (ab209135)

    Applications: SDS-PAGE

  •  
  • Recombinant pig CCL4/MIP-1 beta protein (ab88198)

    Applications: FuncS, SDS-PAGE

  •  
  • Recombinant Dog CCL4/MIP-1 beta protein (ab209117)

    Applications: SDS-PAGE

Clear all

Recently viewed products

  •  
  • Product image

    Anti-ITIH4 antibody (ab246872)

  •  
  • Product image

    Anti-VMAT2 antibody (ab191121)

  •  
  • Product image

    Anti-Wee1 antibody (ab137377)

  •  
  • Product image

    Anti-Use1 antibody (ab251921)

  •  
  • Product image

    Anti-RMND5A antibody (ab254902)

  •  
  • Product image

    Anti-ARID2 antibody (ab245529)

Get resources and offers direct to your inbox Sign up
© 2021 Astana Biomed Group LLP. All rights reserved.