Recombinant rat CCL4/MIP-1 beta protein (ab201370)
Key features and details
- Expression system: Escherichia coli
- Purity: > 95% SDS-PAGE
- Active: Yes
- Suitable for: Functional Studies, HPLC, SDS-PAGE
-
Product name
Recombinant rat CCL4/MIP-1 beta protein
See all CCL4/MIP-1 beta proteins and peptides -
Biological activity
Fully biologically active when compared to standard.
The biological activity determined by a chemotaxis bioassay using Human peripheral blood monocytes is in a concentration range of 10-1000 ng/ml.
-
Purity
> 95 % SDS-PAGE.
>95% by HPLC analysis. -
Expression system
Escherichia coli -
Accession
-
Protein length
Full length protein -
Animal free
No -
Nature
Recombinant -
-
Species
Rat -
Sequence
APIGSDPPTSCCFSYTSRKIHRNFVMDYYETSSLCSQPAVVFLTKKGRQI CADPSEPWVNEYVNDLELN -
Predicted molecular weight
8 kDa -
Amino acids
24 to 92 -
Additional sequence information
Single non-glycosylated polypeptide chain. This product is the mature full length protein from aa 24 to 92. The signal peptide is not included.
-
Preparation and Storage
-
Alternative names
- MIP 1 beta
- Secreted protein G 26
- ACT 2
see all -
Function
Monokine with inflammatory and chemokinetic properties. Binds to CCR5. One of the major HIV-suppressive factors produced by CD8+ T-cells. Recombinant MIP-1-beta induces a dose-dependent inhibition of different strains of HIV-1, HIV-2, and simian immunodeficiency virus (SIV). The processed form MIP-1-beta(3-69) retains the abilities to induce down-modulation of surface expression of the chemokine receptor CCR5 and to inhibit the CCR5-mediated entry of HIV-1 in T-cells. MIP-1-beta(3-69) is also a ligand for CCR1 and CCR2 isoform B. -
Sequence similarities
Belongs to the intercrine beta (chemokine CC) family. -
Post-translational
modificationsN-terminal processed form MIP-1-beta(3-69) is produced by proteolytic cleavage after secretion from peripheral blood lymphocytes. -
Cellular localization
Secreted. - Information by UniProt