Anti-SLC27A5/BAL antibody [CL0213] (ab154140)
Key features and details
- Mouse monoclonal [CL0213] to SLC27A5/BAL
- Suitable for: IHC-P, WB
- Reacts with: Human
- Isotype: IgG1
Overview
-
Product name
Anti-SLC27A5/BAL antibody [CL0213]
See all SLC27A5/BAL primary antibodies -
Description
Mouse monoclonal [CL0213] to SLC27A5/BAL -
Host species
Mouse -
Tested applications
Suitable for: IHC-P, WBmore details -
Species reactivity
Reacts with: Human -
Immunogen
Recombinant fragment corresponding to Human SLC27A5/BAL aa 223-345.
Sequence:RVLVVDPDLRESLEEILPKLQAENIRCFYLSHTSPTPGVGALGAALDAAP SHPVPADLRAGITWRSPALFIYTSGTTGLPKPAILTHERVLQMSKMLSLS GATADDVVYTVLPLYHVMGLVVG
Database link: Q9Y2P5 -
Positive control
- Human liver tissue; Human liver tissue lysate.
-
General notes
The antibody solution should be gently mixed before use.Product previously known as SLC27A5.
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 59% PBS, 40% Glycerol (glycerin, glycerine) -
Concentration information loading...
-
Purity
Protein A purified -
Clonality
Monoclonal -
Clone number
CL0213 -
Isotype
IgG1 -
Research areas
Images
-
Immunohistochemical analysis of Human liver tissue labeling SLC27A5/BAL with ab154140 at 1/500 dilution.
-
Immunohistochemical analysis of Human pancreas tissue showing no labeling of SLC27A5/BAL using ab154140 at 1/500 dilution (negative control).
-
Anti-SLC27A5/BAL antibody [CL0213] (ab154140) at 1/1000 dilution + Human liver tissue lysate
Predicted band size: 75 kDa