Anti-SIX4 antibody (ab176713)
Key features and details
- Rabbit polyclonal to SIX4
- Suitable for: WB, IP
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-SIX4 antibody
See all SIX4 primary antibodies -
Description
Rabbit polyclonal to SIX4 -
Host species
Rabbit -
Tested Applications & Species
See all applications and species dataApplication Species IP HumanWB Human
-
Immunogen
Synthetic peptide within Human SIX4 aa 731-781 (C terminal). The exact sequence is proprietary.
Sequence:SKATSSLMMLDSKSKYVLDGMVDTVCEDLETDKKELAKLQTVQLDEDMQD L
Database link: Q9UIU6 -
Positive control
- WB: HeLa and 293T whole cell lysates. IP HeLa whole cell lysate (ab150035).
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 6.8
Preservative: 0.09% Sodium azide
Constituents: 99% Tris buffered saline, 0.2% BSA
pH 7 to 8 -
Concentration information loading... -
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Images
-
Western blot - Anti-SIX4 antibody (ab176713)All lanes : Anti-SIX4 antibody (ab176713) at 0.04 µg/ml
Lane 1 : HeLa whole cell lysate at 50 µg
Lane 2 : HeLa whole cell lysate at 15 µg
Lane 3 : 293T whole cell lysate at 50 µg
Developed using the ECL technique.
Predicted band size: 83 kDa
Exposure time: 30 seconds
-
Immunoprecipitation - Anti-SIX4 antibody (ab176713)SIX4 was immunoprecipitated from 1mg HeLa whole cell lysate using ab176713 at 6 μg/mg lysate (Lane 2), a rabbit anti-SIX4 antibody recognizing an upstream epitope (Lane 1) or control IgG (Lane 3). 20% of the Immunoprecipitate was loaded per lane and then immunobotted using ab176713 at 0.4 μg/ml.
Detection: Chemiluminescence with exposure time of 3 seconds.
