Anti-SPTLC1 antibody (ab176706)
Key features and details
- Rabbit polyclonal to SPTLC1
- Suitable for: WB, IP
- Reacts with: Mouse, Human
- Isotype: IgG
Overview
-
Product name
Anti-SPTLC1 antibody
See all SPTLC1 primary antibodies -
Description
Rabbit polyclonal to SPTLC1 -
Host species
Rabbit -
Tested applications
Suitable for: WB, IPmore details -
Species reactivity
Reacts with: Mouse, Human
Predicted to work with: Rabbit, Horse, Chicken, Guinea pig, Cow, Pig, Chimpanzee, Cynomolgus monkey, Rhesus monkey
-
Immunogen
Synthetic peptide within Human SPTLC1 aa 50-100. The exact sequence is proprietary. NP_006406.1.
Sequence:SDLTVKEKEELIEEWQPEPLVPPVPKDHPALNYNIVSGPPSHKTVVNGKE C
Database link: O15269 -
Positive control
- HeLa, 293T, Jurkat and NIH3T3 whole cell lysates.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 6.8
Preservative: 0.09% Sodium azide
Constituents: 0.1% BSA, 99% Tris buffered saline -
Concentration information loading... -
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Images
-
Western blot - Anti-SPTLC1 antibody (ab176706)All lanes : Anti-SPTLC1 antibody (ab176706) at 0.04 µg/ml
Lane 1 : HeLa whole cell lysate at 50 µg
Lane 2 : HeLa whole cell lysate at 15 µg
Lane 3 : 293T whole cell lysate at 50 µg
Lane 4 : Jurkat whole cell lysate at 50 µg
Lane 5 : NIH3T3 whole cell lysate at 50 µg
Developed using the ECL technique.
Predicted band size: 53 kDa
Exposure time: 30 seconds
-
Immunoprecipitation - Anti-SPTLC1 antibody (ab176706)ab176706 at 0.4 µg/ml detecting SPTLC1 in HeLa whole cell lysate by WB following IP.
Lane 1: ab176706 at 6 µg/mg of lysate
Lane 2: IP with an antibody which recognizes an downstream epitope of SPTLC1.
Lane 3: Control IgG.
In each case, 1 mg of lysate was used for IP and 20% of the IP was loaded.
Detection: Chemiluminescence with an exposure time of 10 seconds.
