Call: +7 771 977 66 65, +7 705 421 2277
Sign in or Register
My basket

Astana Biomed Group, an authorized Abcam distributor in Central Asia

Abiomed homepage

  • Categories
    Signal Transduction
    Cancer
    Epigenetics and Nuclear Signaling
    Immunology
    Cell Biology
    Cardiovascular
    Neuroscience
    Tags & Cell Markers
    Kits/ Lysates/ Other
    Developmental Biology
    Microbiology
    Biochemicals
    Secondary antibodies
    Isotype/Loading Controls
    Antibody Arrays
  • About us
  • Partners
  • Contact
    Address

    Saryarka 32, 18, 010000, Astana city, Kazakhstan

    Telephone +7 771 977 66 65, +7 705 421 2277

    Email

    laboratory@ctlab.kz, orders@abiomed.kz

Back to category

Anti-SPTLC1 antibody (ab176706)

Price and availability

284 784 ₸

Availability

Order now and get it on Thursday February 25, 2021

Anti-SPTLC1 antibody (ab176706)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)

Key features and details

  • Rabbit polyclonal to SPTLC1
  • Suitable for: WB, IP
  • Reacts with: Mouse, Human
  • Isotype: IgG

You may also be interested in

Product image
Anti-OSBPL5/ORP5 antibody (ab220143)
Product image
Anti-Histone H3 (butyryl K79) antibody (ab241462)
Product image
Anti-HEC1/HEC antibody (ab230916)
Product image
Human RAB7A (RAB7) knockout HeLa cell line (ab255423)

Overview

  • Product name

    Anti-SPTLC1 antibody
    See all SPTLC1 primary antibodies
  • Description

    Rabbit polyclonal to SPTLC1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IPmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Rabbit, Horse, Chicken, Guinea pig, Cow, Pig, Chimpanzee, Cynomolgus monkey, Rhesus monkey
  • Immunogen

    Synthetic peptide within Human SPTLC1 aa 50-100. The exact sequence is proprietary. NP_006406.1.
    Sequence:

    SDLTVKEKEELIEEWQPEPLVPPVPKDHPALNYNIVSGPPSHKTVVNGKE C


    Database link: O15269
    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
  • Positive control

    • HeLa, 293T, Jurkat and NIH3T3 whole cell lysates.
  • General notes

    Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.

    Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.

    We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.

    In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.

    We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.

    Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.

    Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 6.8
    Preservative: 0.09% Sodium azide
    Constituents: 0.1% BSA, 99% Tris buffered saline
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

    • Cardiovascular
    • Lipids / Lipoproteins
    • Lipid Metabolism
    • Cholesterol Metabolism
    • Neuroscience
    • Neurology process
    • Neurodegenerative disease
    • Other
    • Signal Transduction
    • Metabolism
    • Lipid metabolism
    • Cancer
    • Cancer Metabolism
    • Metabolic signaling pathway
    • Metabolism of lipids and lipoproteins
    • Metabolism
    • Pathways and Processes
    • Metabolic signaling pathways
    • Lipid and lipoprotein metabolism
    • Lipid metabolism
    • Metabolism
    • Pathways and Processes
    • Metabolic signaling pathways
    • Lipid and lipoprotein metabolism
    • Cholesterol Metabolism

Images

  • Western blot - Anti-SPTLC1 antibody (ab176706)
    Western blot - Anti-SPTLC1 antibody (ab176706)
    All lanes : Anti-SPTLC1 antibody (ab176706) at 0.04 µg/ml

    Lane 1 : HeLa whole cell lysate at 50 µg
    Lane 2 : HeLa whole cell lysate at 15 µg
    Lane 3 : 293T whole cell lysate at 50 µg
    Lane 4 : Jurkat whole cell lysate at 50 µg
    Lane 5 : NIH3T3 whole cell lysate at 50 µg

    Developed using the ECL technique.

    Predicted band size: 53 kDa


    Exposure time: 30 seconds
  • Immunoprecipitation - Anti-SPTLC1 antibody (ab176706)
    Immunoprecipitation - Anti-SPTLC1 antibody (ab176706)

    ab176706 at 0.4 µg/ml detecting SPTLC1 in HeLa whole cell lysate by WB following IP. 

    Lane 1: ab176706 at 6 µg/mg of lysate
    Lane 2: IP with an antibody which recognizes an downstream epitope of SPTLC1.
    Lane 3: Control IgG. 

    In each case, 1 mg of lysate was used for IP and 20% of the IP was loaded.

    Detection: Chemiluminescence with an exposure time of 10 seconds.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Alternative products to Anti-SPTLC1 antibody (ab176706)

  •  
  • Product image

    Anti-SPTLC1 antibody (ab232847)

    Applications: IHC-P, WB

  •  
  • Product image

    Anti-SPTLC1 antibody (ab264321)

    Applications: IP, WB

Clear all

Recently viewed products

  •  
  • Product image

    Anti-Rab18 antibody (ab182764)

  •  
  • Product image

    Anti-NUCB2 antibody (ab223123)

  •  
  • Product image

    Anti-DKK2 antibody (ab264046)

  •  
  • Product image

    Recombinant human PIK3C2B protein (Active) (ab268865)

  •  
  • Product image

    Human BMPR1A knockout HeLa cell lysate (ab257193)

Get resources and offers direct to your inbox Sign up
© 2021 Astana Biomed Group LLP. All rights reserved.