Anti-RFC4 antibody [OTI1A8] (ab156780)
Key features and details
- Mouse monoclonal [OTI1A8] to RFC4
- Suitable for: WB, IHC-P, ICC/IF
- Reacts with: Mouse, Rat, Dog, Human, African green monkey
- Isotype: IgG1
Overview
-
Product name
Anti-RFC4 antibody [OTI1A8]
See all RFC4 primary antibodies -
Description
Mouse monoclonal [OTI1A8] to RFC4 -
Host species
Mouse -
Tested Applications & Species
See all applications and species dataApplication Species ICC/IF African green monkeyIHC-P HumanWB Human -
Immunogen
Recombinant full length protein corresponding to Human RFC4 aa 1-363. Produced in HEK-293T cells (NP_002907).
Sequence:MQAFLKGTSISTKPPLTKDRGVAASAGSSGENKKAKPVPWVEKYRPKCVD EVAFQEEVVAVLKKSLEGADLPNLLFYGPPGTGKTSTILAAARELFGPEL FRLRVLELNASDERGIQVVREKVKNFAQLTVSGSRSDGKPCPPFKIVILD EADSMTSAAQAALRRTMEKESKTTRFCLICNYVSRIIEPLTSRCSKFRFK PLSDKIQQQRLLDIAKKENVKISDEGIAYLVKVSEGDLRKAITFLQSATR LTGGKEITEKVITDIAGVIPAEKIDGVFAACQSGSFDKLEAVVKDLIDEG HAATQLVNQLHDVVVENNLSDKQKSIITEKLAEVDKCLADGADEHLQLIS LCATVMQQLSQNC
Database link: P35249 -
Positive control
- WB: HEK-293T cells lysate transfected with pCMV6-ENTRY RFC4 cDNA; HepG2, HeLa, SVT2, A549, COS-7, Jurkat, MDCK, PC-12 and MCF7 cell extracts. IHC-P: Human pancreas, pancreas carcinoma and tonsil tissues. ICC/IF: COS-7 cells transiently transfected by pCMV6-ENTRY RFC4 cDNA.
-
General notes
Clone OTI1A8 (formerly 1A8).
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing the problem with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation.
One factor contributing to the crisis is the use of antibodies that are not suitable. This can lead to misleading results and the use of incorrect data informing project assumptions and direction. To help address this challenge, we have introduced an application and species grid on our primary antibody datasheets to make it easy to simplify identification of the right antibody for your needs.
Learn more here.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.30
Preservative: 0.02% Sodium azide
Constituents: PBS, 1% BSA, 50% Glycerol -
Concentration information loading...
-
Purity
Affinity purified -
Purification notes
Purified from cell culture supernatant. -
Clonality
Monoclonal -
Clone number
OTI1A8 -
Isotype
IgG1 -
Research areas
Images
-
All lanes : Anti-RFC4 antibody [OTI1A8] (ab156780) at 1/200 dilution
Lane 1 : HEK-293T (Human epithelial cell line from embryonic kidney transformed with large T antigen) cell lysate transfected with pCMV6-ENTRY control
Lane 2 : HEK-293T cell lysate transfected with pCMV6-ENTRY RFC4 cDNA
Lysates/proteins at 5 µg per lane.
Predicted band size: 40 kDa
-
All lanes : Anti-RFC4 antibody [OTI1A8] (ab156780) at 1/200 dilution
Lane 1 : HepG2 (human liver hepatocellular carcinoma cell line) cell extract
Lane 2 : HeLa (human epithelial cell line from cervix adenocarcinoma) cell extract
Lane 3 : SVT2 cell extract
Lane 4 : A549 (human lung carcinoma cell line) cell extract
Lane 5 : COS-7 (african green monkey kidney fibroblast-like cell line) cell extract
Lane 6 : Jurkat (human T cell leukemia cell line from peripheral blood) cell extract
Lane 7 : MDCK (Canine kidney cell line) cell extract
Lane 8 : PC12 (Rat adrenal gland pheochromocytoma cell line) cell extract
Lane 9 : MCF7 (Human breast adenocarcinoma cell line) cell extract
Lysates/proteins at 35 µg per lane.
Predicted band size: 40 kDa
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-RFC4 antibody [OTI1A8] (ab156780)
Paraffin-embedded human pancreas tissue stained for RFC4 using ab156780 at 1/150 dilution in immunohistochemical analysis.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-RFC4 antibody [OTI1A8] (ab156780)
Paraffin-embedded human pancreas carcinoma tissue stained for RFC4 using ab156780 at 1/150 dilution in immunohistochemical analysis.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-RFC4 antibody [OTI1A8] (ab156780)
Paraffin-embedded human tonsil tissue stained for RFC4 using ab156780 at 1/150 dilution in immunohistochemical analysis.
-
COS-7 (african green monkey kidney fibroblast-like cell line) cells transiently transfected with pCMV6-ENTRY RFC4 cDNA using ab156780 at 1/100 dilution in ICC/IF.