Anti-Rad51 antibody (ab176458)
Key features and details
- Rabbit polyclonal to Rad51
- Suitable for: WB, IP, ICC/IF, IHC-P
- Reacts with: Mouse, Human, Xenopus laevis, Chinese hamster
- Isotype: IgG
Overview
-
Product name
Anti-Rad51 antibody
See all Rad51 primary antibodies -
Description
Rabbit polyclonal to Rad51 -
Host species
Rabbit -
Tested Applications & Species
See all applications and species dataApplication Species ICC/IF HumanIHC-P MouseIP HumanWB Human -
Immunogen
Recombinant full length protein corresponding to Human Rad51 aa 1-339.
Sequence:MAMQMQLEANADTSVEEESFGPQPISRLEQCGINANDVKKLEEAGFHTVE AVAYAPKKELINIKGISEAKADKILAEAAKLVPMGFTTATEFHQRRSEII QITTGSKELDKLLQGGIETGSITEMFGEFRTGKTQICHTLAVTCQLPIDR GGGEGKAMYIDTEGTFRPERLLAVAERYGLSGSDVLDNVAYARAFNTDHQ TQLLYQASAMMVESRYALLIVDSATALYRTDYSGRGELSARQMHLARFLR MLLRLADEFGVAVVITNQVVAQVDGAAMFAADPKKPIGGNIIAHASTTRL YLRKGRGETRICKIYDSPCLPEAEAMFAINADGVGDAKD
Database link: Q06609 -
General notes
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing the problem with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation.
One factor contributing to the crisis is the use of antibodies that are not suitable. This can lead to misleading results and the use of incorrect data informing project assumptions and direction. To help address this challenge, we have introduced an application and species grid on our primary antibody datasheets to make it easy to simplify identification of the right antibody for your needs.
Learn more here.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 6.00
Constituents: 50% Glycerol (glycerin, glycerine), 50% PBS
Azide and carrier free. -
Concentration information loading... -
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Images
-
All lanes : Anti-Rad51 antibody (ab176458) at 1/1000 dilution
Lane 1 : MCF7 (human breast adenocarcinoma cell line) cell lysate
Lane 2 : NIH3T3 (Mouse embryo fibroblast cell line) cell lysate
Lane 3 : CHO (Chinese hamster ovary cell line) cell lysate
Lane 4 : Xenopus laevis egg
Lysates/proteins at 40 µg per lane.
Predicted band size: 36 kDa
-
Immunofluorescence detection of Rad51 foci formation after X-ray irradiation in GM0637 cells with ab176458 at 1/10000 dilution (left panels) and 1/1000 dilution (right panels). The secondary antibody, anti-rabbit Alexa 488 was used at 1/10000 dilution.
Cells were irradiated by X-rays at 2 Gy, grown for 1 hr, fixed with 4% paraformaldehyde in 1x PBS for 10 min, washed 3 times with PBS for 3 min, permealized by treatment with 0.5% Triton for 5 min, washed 3 times with PBS for 3 min, incubated with ab176458 for 30 min at 37°C, washed 3 times with PBS for 3 min, incubated with secondary antibody for 30 min at 37°C, washed 3 times with PBS for 3 min, stained with Hoechst for 1 min and mounted.
The pictures were by courtesy of Prof. S. Tashiro and Dr. K. Kono at Hiroshima University.
-
Anti-Rad51 antibody (ab176458) at 1/1000 dilution + Crude HeLa cell extracts at 10 µg
Secondary
Goat anti-Rabbit IgG conjugated to HRP at 1/20000 dilution
Predicted band size: 36 kDa
-
ab176458 (20 µg) was incubated with 20 μg of HeLa cell extract, and precipitated with 20 μg of proteinA-beads. The sample was dissociated from the precipitate by heating in SDS-sample buffer and analyzed by western blotting with anti-Rad51 antiserum (chicken, ab63802) at 1/1000 dilution. As secondary antibody, anti-chicken IgG antibody (rabbit) was used at 1/10000 dilution.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Rad51 antibody - ChIP Grade (ab176458)Immunohistological staining of Rad51 protein in mouse testis using ab176458. A section of formalin fixed and paraffin embedded mouse testis was treated with ab176458 at 1/100 dilution after deparaffization and antigen retrieval. The secondary antibody, Alexa Fluor® 647conjugated anti-rabbit IgG was used at 1/1,000 dilution (top left). The sample was counter-stained with DAPI (top right) and the merged image is shown (bottom left). The white light image of the same region is shown on the bottom right.

