Call: +7 771 977 66 65, +7 705 421 2277
Sign in or Register
My basket

Astana Biomed Group, an authorized Abcam distributor in Central Asia

Abiomed homepage

  • Categories
    Signal Transduction
    Cancer
    Epigenetics and Nuclear Signaling
    Immunology
    Cell Biology
    Cardiovascular
    Neuroscience
    Tags & Cell Markers
    Kits/ Lysates/ Other
    Developmental Biology
    Microbiology
    Biochemicals
    Secondary antibodies
    Isotype/Loading Controls
    Antibody Arrays
  • About us
  • Partners
  • Contact
    Address

    Saryarka 32, 18, 010000, Astana city, Kazakhstan

    Telephone +7 771 977 66 65, +7 705 421 2277

    Email

    laboratory@ctlab.kz, orders@abiomed.kz

Back to category
Epigenetics and Nuclear Signaling DNA / RNA RNA Processing Splicing

Anti-PRPF8/Prp8 antibody (ab157114)

Anti-PRPF8/Prp8 antibody (ab157114)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)

Key features and details

  • Rabbit polyclonal to PRPF8/Prp8
  • Suitable for: WB
  • Reacts with: Mouse, Human
  • Isotype: IgG

You may also be interested in

Product image
Anti-SRSF3 antibody [EPR16976] - BSA and Azide free (ab251252)
Product image
Anti-DDX42 antibody (ab89075)
Product image
Anti-LSM2 antibody [EPR7216] - BSA and Azide free (ab248322)
Product image
Anti-Gemin 8 antibody (ab224758)

Overview

  • Product name

    Anti-PRPF8/Prp8 antibody
    See all PRPF8/Prp8 primary antibodies
  • Description

    Rabbit polyclonal to PRPF8/Prp8
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Dog, Turkey, Pig, Xenopus laevis, Zebrafish, Rhesus monkey, Gorilla, Orangutan, Xenopus tropicalis
  • Immunogen

    Synthetic peptide corresponding to Human PRPF8/Prp8 aa 850-900.
    Sequence:

    YSVKSRLNQSQREELGLIEQAYDNPHEALSRIKRHLLTQRAFKEVGIEFM D


    Database link: NP_006436.3
    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
  • Positive control

    • 293T, HeLa, Jurkat and NIH 3T3 whole cell lysates.
  • General notes

    Previously labelled as PRPF8. 

    Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.

    Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.

    We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.

    In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.

    We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.

    Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.

    Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
  • Storage buffer

    pH: 7
    Preservative: 0.09% Sodium azide
    Constituent: 99% Tris citrate/phosphate

    pH 7 to 8
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

    • Epigenetics and Nuclear Signaling
    • DNA / RNA
    • RNA Processing
    • Splicing
    • Neuroscience
    • Sensory System
    • Visual system

Images

  • Western blot - Anti-PRPF8/Prp8 antibody (ab157114)
    Western blot - Anti-PRPF8/Prp8 antibody (ab157114)
    All lanes : Anti-PRPF8/Prp8 antibody (ab157114) at 0.1 µg/ml

    Lane 1 : 293T whole cell lysate at 50 µg
    Lane 2 : 293T whole cell lysate at 15 µg
    Lane 3 : HeLa whole cell lysate at 50 µg
    Lane 4 : Jurkat whole cell lysate at 50 µg
    Lane 5 : NIH 3T3 whole cell lysate at 50 µg

    Developed using the ECL technique.

    Predicted band size: 274 kDa


    Exposure time: 3 seconds

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Alternative products to Anti-PRPF8/Prp8 antibody (ab157114)

  •  
  • Product image

    Anti-PRPF8/Prp8 antibody [EPR15228] (ab190347)

    Applications: IHC-P, WB

  •  
  • Product image

    Anti-PRPF8/Prp8 antibody [2834C1a] (ab51366)

    Applications: Flow Cyt, IHC-P, WB

  •  
  • Product image

    Anti-PRPF8/Prp8 antibody (ab137694)

    Applications: WB

  •  
  • Product image

    Anti-PRPF8/Prp8 antibody [EPR15229] - BSA and Azide free (ab239003)

    Applications: Flow Cyt, ICC/IF, IHC-P, WB

  •  
  • Product image

    Anti-PRPF8/Prp8 antibody [EPR15229] - C-terminal (ab185547)

    Applications: Flow Cyt, ICC/IF, IHC-P, WB

  •  
  • Product image

    Anti-PRPF8/Prp8 antibody (ab79237)

    Applications: ICC/IF, IHC-P, IP, WB

Clear all

Recently viewed products

  •  
  • Product image

    Anti-PTBP1 antibody [SH54] (ab30317)

  •  
  • Product image

    Anti-Chordin antibody (ab279579)

  •  
  • Product image

    Human DKK1 ELISA Kit (Dickkopf-1) (ab100501)

  •  
  • Product image

    Anti-JAKMIP1 antibody (ab156853)

Get resources and offers direct to your inbox Sign up
© 2021 Astana Biomed Group LLP. All rights reserved.