Anti-Protein CASP antibody [2A10] (ab54583)
Key features and details
- Mouse monoclonal [2A10] to Protein CASP
- Suitable for: IHC-P, WB, ICC/IF, Sandwich ELISA, Flow Cyt
- Reacts with: Human, Recombinant fragment
- Isotype: IgG1
Overview
-
Product name
Anti-Protein CASP antibody [2A10]
See all Protein CASP primary antibodies -
Description
Mouse monoclonal [2A10] to Protein CASP -
Host species
Mouse -
Tested Applications & Species
See all applications and species dataApplication Species Flow Cyt HumanICC/IF HumanIHC-P HumanWB HumanRecombinant fragment -
Immunogen
Recombinant fragment (GST-tag) corresponding to Human Protein CASP aa 521-620. NP_001904.2
Sequence:AENRLAQHTLQALQSELDSLRADNIKLFEKIKFLQSYPGRGSGSDDTELR YSSQYEERLDPFSSFSKRERQRKYLSLSPWDKATLSMGRLVLSNKMARTI
Database link: Q13948 -
Positive control
- ICC/IF: HeLa cells. IHC-P: Human spleen tissue; human malignant lymphoma, diffuse large B tissue. Flow Cytometry: MCF7 cells. WB: Protein CASP transfected HEK-293T cell lysate. Recombinant Protein CASP protein.
-
General notes
This product was changed from ascites to tissue culture supernatant on 13th Feb 2019. Please note that the dilutions may need to be adjusted accordingly. If you have any questions, please do not hesitate to contact our scientific support team.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. -
Storage buffer
pH: 7.40
Constituent: PBS -
Concentration information loading...
-
Purity
Tissue culture supernatant -
Clonality
Monoclonal -
Clone number
2A10 -
Isotype
IgG1 -
Light chain type
kappa -
Research areas
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Protein CASP antibody [2A10] (ab54583)
Formalin-fixed, paraffin-embedded human spleen tissue stained for Protein CASP with ab54583 at 5 µg/ml in immunohistochemical analysis.
This image was generated using the ascites version of the product.
-
HeLa (human epithelial cell line from cervix adenocarcinoma) cells stained for Protein CASP (green) using ab54583 at 10 µg/ml in ICC/IF.
This image was generated using the ascites version of the product.
-
Overlay histogram showing MCF7 (human breast adenocarcinoma cell line) cells stained with ab54583 (red line). The cells were fixed with 80% methanol (5 minutes) and then permeabilized with 0.1% PBS-Tween for 20 minutes. The cells were then incubated in 1x PBS / 10% normal goat serum / 0.3 M glycine to block non-specific protein-protein interactions followed by the antibody (ab54583, 1 µg/1 x 106 cells) for 30 minutes at 22ºC. The secondary antibody used was DyLight® 488 goat anti-mouse IgG (H+L) (ab96879) at 1/500 dilution for 30 minutes at 22ºC. Isotype control antibody (black line) was mouse IgG1 [ICIGG1] (ab91353, 2 µg/1 x 106 cells) used under the same conditions. Acquisition of >5,000 events was performed. This antibody gave a positive signal in MCF7 cells fixed with 4% paraformaldehyde (10 minutes)/permeabilized in 0.1% PBS-Tween used under the same conditions.
This image was generated using the ascites version of the product.
-
All lanes : Anti-Protein CASP antibody [2A10] (ab54583) at 5 µg/ml
Lane 1 : Protein CASP transfected HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) cell lysate
Lane 2 : Non-transfected HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) cell lysateThis image was generated using the ascites version of the product.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Protein CASP antibody [2A10] (ab54583)
Formalin-fixed, paraffin-embedded human malignant lymphoma, diffuse large B tissue stained for Protein CASP with ab54583 at 5 µg/ml in immunohistochemical analysis.
This image was generated using the ascites version of the product.
-
Anti-Protein CASP antibody [2A10] (ab54583) at 5 µg/ml + Tagged recombinant Protein CASP protein
This antibody has only been tested in WB against the recombinant fragment used as immunogen. We have no data on the detection of endogenous protein.
Expected MW 38 kDa.
This image was generated using the ascites version of the product.
-
Detection limit of ab54583 is approximately 0.03 ng/ml as a capture antibody.
This image was generated using the ascites version of the product.