Call: +7 771 977 66 65, +7 705 421 2277
Sign in or Register
My basket

Astana Biomed Group, an authorized Abcam distributor in Central Asia

Abiomed homepage

  • Categories
    Signal Transduction
    Cancer
    Epigenetics and Nuclear Signaling
    Immunology
    Cell Biology
    Cardiovascular
    Neuroscience
    Tags & Cell Markers
    Kits/ Lysates/ Other
    Developmental Biology
    Microbiology
    Biochemicals
    Secondary antibodies
    Isotype/Loading Controls
    Antibody Arrays
  • About us
  • Partners
  • Contact
    Address

    Saryarka 32, 18, 010000, Astana city, Kazakhstan

    Telephone +7 771 977 66 65, +7 705 421 2277

    Email

    laboratory@ctlab.kz, orders@abiomed.kz

Back to category
Signal Transduction Signaling Pathway G Protein Signaling Small G Proteins Other

Anti-Protein CASP antibody [2A10] (ab54583)

Price and availability

381 945 ₸

Availability

Order now and get it on Tuesday March 02, 2021

Anti-Protein CASP antibody [2A10] (ab54583)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)

Key features and details

  • Mouse monoclonal [2A10] to Protein CASP
  • Suitable for: IHC-P, WB, ICC/IF, Sandwich ELISA, Flow Cyt
  • Reacts with: Human, Recombinant fragment
  • Isotype: IgG1

You may also be interested in

Product image
Anti-PI3 Kinase p110 beta antibody [Y384] (ab32569)
Product image
Anti-ASF1b antibody [004] (ab276071)
Product image
Anti-MCM2 antibody [SP85] - BSA and Azide free (ab240933)
Recombinant human SCGF beta protein (ab9836)

Overview

  • Product name

    Anti-Protein CASP antibody [2A10]
    See all Protein CASP primary antibodies
  • Description

    Mouse monoclonal [2A10] to Protein CASP
  • Host species

    Mouse
  • Tested Applications & Species

    Application Species
    Flow Cyt
    Human
    ICC/IF
    Human
    IHC-P
    Human
    WB
    Human
    Recombinant fragment
    See all applications and species data
  • Immunogen

    Recombinant fragment (GST-tag) corresponding to Human Protein CASP aa 521-620. NP_001904.2
    Sequence:

    AENRLAQHTLQALQSELDSLRADNIKLFEKIKFLQSYPGRGSGSDDTELR YSSQYEERLDPFSSFSKRERQRKYLSLSPWDKATLSMGRLVLSNKMARTI


    Database link: Q13948
    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
  • Positive control

    • ICC/IF: HeLa cells. IHC-P: Human spleen tissue; human malignant lymphoma, diffuse large B tissue. Flow Cytometry: MCF7 cells. WB: Protein CASP transfected HEK-293T cell lysate. Recombinant Protein CASP protein.
  • General notes

    This product was changed from ascites to tissue culture supernatant on 13th Feb 2019. Please note that the dilutions may need to be adjusted accordingly. If you have any questions, please do not hesitate to contact our scientific support team.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
  • Storage buffer

    pH: 7.40
    Constituent: PBS
  • Concentration information loading...
  • Purity

    Tissue culture supernatant
  • Clonality

    Monoclonal
  • Clone number

    2A10
  • Isotype

    IgG1
  • Light chain type

    kappa
  • Research areas

    • Epigenetics and Nuclear Signaling
    • Transcription
    • Domain Families
    • Developmental Families
    • Other
    • Epigenetics and Nuclear Signaling
    • Transcription
    • Co-factors
    • Epigenetics and Nuclear Signaling
    • Chromatin Binding Proteins
    • DNA / RNA binding

Images

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Protein CASP antibody [2A10] (ab54583)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Protein CASP antibody [2A10] (ab54583)

    Formalin-fixed, paraffin-embedded human spleen tissue stained for Protein CASP with ab54583 at 5 µg/ml in immunohistochemical analysis.

    This image was generated using the ascites version of the product.

  • Immunocytochemistry/ Immunofluorescence - Anti-Protein CASP antibody [2A10] (ab54583)
    Immunocytochemistry/ Immunofluorescence - Anti-Protein CASP antibody [2A10] (ab54583)

    HeLa (human epithelial cell line from cervix adenocarcinoma) cells stained for Protein CASP (green) using ab54583 at 10 µg/ml in ICC/IF.

    This image was generated using the ascites version of the product.

  • Flow Cytometry - Anti-Protein CASP antibody [2A10] (ab54583)
    Flow Cytometry - Anti-Protein CASP antibody [2A10] (ab54583)

    Overlay histogram showing MCF7 (human breast adenocarcinoma cell line) cells stained with ab54583 (red line). The cells were fixed with 80% methanol (5 minutes) and then permeabilized with 0.1% PBS-Tween for 20 minutes. The cells were then incubated in 1x PBS / 10% normal goat serum / 0.3 M glycine to block non-specific protein-protein interactions followed by the antibody (ab54583, 1 µg/1 x 106 cells) for 30 minutes at 22ºC. The secondary antibody used was DyLight® 488 goat anti-mouse IgG (H+L) (ab96879) at 1/500 dilution for 30 minutes at 22ºC. Isotype control antibody (black line) was mouse IgG1 [ICIGG1] (ab91353, 2 µg/1 x 106 cells) used under the same conditions. Acquisition of >5,000 events was performed. This antibody gave a positive signal in MCF7 cells fixed with 4% paraformaldehyde (10 minutes)/permeabilized in 0.1% PBS-Tween used under the same conditions.

    This image was generated using the ascites version of the product.

  • Western blot - Anti-Protein CASP antibody [2A10] (ab54583)
    Western blot - Anti-Protein CASP antibody [2A10] (ab54583)
    All lanes : Anti-Protein CASP antibody [2A10] (ab54583) at 5 µg/ml

    Lane 1 : Protein CASP transfected HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) cell lysate
    Lane 2 : Non-transfected HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) cell lysate


    This image was generated using the ascites version of the product.

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Protein CASP antibody [2A10] (ab54583)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Protein CASP antibody [2A10] (ab54583)

    Formalin-fixed, paraffin-embedded human malignant lymphoma, diffuse large B tissue stained for Protein CASP with ab54583 at 5 µg/ml in immunohistochemical analysis.

    This image was generated using the ascites version of the product.

  • Western blot - Anti-Protein CASP antibody [2A10] (ab54583)
    Western blot - Anti-Protein CASP antibody [2A10] (ab54583)
    Anti-Protein CASP antibody [2A10] (ab54583) at 5 µg/ml + Tagged recombinant Protein CASP protein


    This antibody has only been tested in WB against the recombinant fragment used as immunogen. We have no data on the detection of endogenous protein.

    Expected MW 38 kDa.

    This image was generated using the ascites version of the product.

  • Sandwich ELISA - Anti-Protein CASP antibody [2A10] (ab54583)
    Sandwich ELISA - Anti-Protein CASP antibody [2A10] (ab54583)

    Detection limit of ab54583 is approximately 0.03 ng/ml as a capture antibody.

    This image was generated using the ascites version of the product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Alternative products to Anti-Protein CASP antibody [2A10] (ab54583)

  •  
  • Product image

    Anti-Protein CASP antibody (ab230844)

    Applications: IHC-P, WB

  •  
  • Product image

    Anti-Protein CASP antibody [EPR18806] (ab182216)

    Applications: Flow Cyt, ICC/IF, IP, WB

  •  
  • Product image

    Anti-Protein CASP antibody (ab244269)

    Applications: ICC/IF, IHC-P, WB

Clear all

Recently viewed products

  •  
  • Product image

    Anti-CYLD antibody (ab137524)

  •  
  • Product image

    Anti-CLASP1 antibody (ab154087)

  •  
  • Product image

    Mouse PF4 Matched Antibody Pair Kit (ab211763)

  •  
  • Product image

    Anti-LEAP2 antibody (ab231955)

  •  
  • Product image

    Anti-RALA antibody (ab236314)

  •  
  • Product image

    Anti-SASH3 antibody (ab251656)

Get resources and offers direct to your inbox Sign up
© 2021 Astana Biomed Group LLP. All rights reserved.