Call: +7 771 977 66 65, +7 705 421 2277
Sign in or Register
My basket

Astana Biomed Group, an authorized Abcam distributor in Central Asia

Abiomed homepage

  • Categories
    Signal Transduction
    Cancer
    Epigenetics and Nuclear Signaling
    Immunology
    Cell Biology
    Cardiovascular
    Neuroscience
    Tags & Cell Markers
    Kits/ Lysates/ Other
    Developmental Biology
    Microbiology
    Biochemicals
    Secondary antibodies
    Isotype/Loading Controls
    Antibody Arrays
  • About us
  • Partners
  • Contact
    Address

    Saryarka 32, 18, 010000, Astana city, Kazakhstan

    Telephone +7 771 977 66 65, +7 705 421 2277

    Email

    laboratory@ctlab.kz, orders@abiomed.kz

Back to category

Anti-PMPCA/INPP5E antibody (ab140171)

Anti-PMPCA/INPP5E antibody (ab140171)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)

Key features and details

  • Rabbit polyclonal to PMPCA/INPP5E
  • Suitable for: WB, IHC-P
  • Reacts with: Human
  • Isotype: IgG

You may also be interested in

Product image
Human ECHDC1 knockout HeLa cell lysate (ab258855)
Product image
Anti-eIF-6 antibody (ab109593)
Product image
Olanzapine, 5-HT, dopamine, histamine and muscarinic antagonist (ab120736)
Product image
Recombinant Human HEXA protein (denatured) (ab140049)

Overview

  • Product name

    Anti-PMPCA/INPP5E antibody
    See all PMPCA/INPP5E primary antibodies
  • Description

    Rabbit polyclonal to PMPCA/INPP5E
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Dog
  • Immunogen

    Recombinant fragment corresponding to Human PMPCA/INPP5E aa 186-370.
    Sequence:

    MAVQFELEDLNLRPDPEPLLTEMIHEAAYRENTVGLHRFCPTENVAKINR EVLHSYLRNYYTPDRMVLAGVGVEHEHLVDCARKYLLGVQPAWGSAEAVD IDRSVAQYTGGIAKLERDMSNVSLGPTPIPELTHIMVGLESCSFLEEDFI PFAVLNMMMGGGGSFSAGGPGKGMFSRLYLNVLNR

    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
  • Positive control

    • MCF7 and A549 cell lysates; Human fetal colon tissue.
  • General notes

     This product was previously labelled as PMPCA

     

    Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.

    Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.

    We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.

    In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.

    We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.

    Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.

    Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.

Properties

  • Form

    Lyophilized:Reconstitute with 200ul distilled sterile water. Please note that if you receive this product in liquid form it has already been reconstituted as described and no further reconstitution is necessary.
  • Storage instructions

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.
  • Storage buffer

    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: 1% BSA, 98% PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

    • Tags & Cell Markers
    • Subcellular Markers
    • Organelles
    • Mitochondria
    • Signal Transduction
    • Protein Trafficking
    • Organelle Proteins
    • Cell Biology
    • Proteolysis / Ubiquitin
    • Proteolytic enzymes
    • Other proteases

Images

  • Western blot - Anti-PMPCA/INPP5E antibody (ab140171)
    Western blot - Anti-PMPCA/INPP5E antibody (ab140171) This image is courtesy of an Abreview submitted by Svitlana Yablonska.
    All lanes : Anti-PMPCA/INPP5E antibody (ab140171) at 1/1000 dilution

    Lane 1 : Mouse whole brain homogenate
    Lane 2 : Mice brain non-synaptosomal mitochondria
    Lane 3 : Mitochondria from ST-Hdh-Q7/Q7 striatal cells
    Lane 4 : Mitochondria from ST-Hdh-Q111/Q111 striatal cells
    Lane 5 : HEK293 whole cell homogenate
    Lane 6 : Mitochondria from HEK293 cells

    Lysates/proteins at 20 µg per lane.

    Secondary
    All lanes : IRDye 800CY-conjugated monoclonal goat anti-rabbit IgG at 1/15000 dilution

    Performed under reducing conditions.

    Predicted band size: 58 kDa
    Observed band size: 50 kDa
    why is the actual band size different from the predicted?
    Additional bands at: 40 kDa (possible non-specific binding)


    Exposure time: 5 minutes


    Protein standard (bands from the top to the bottom: 250, 150, 100, 75 (yellow), 50, 37, 25 (yellow), 20, 15 kDa.

    Blocked for 1 hour at 25°C. Incubated with the primary antibody for 16 hours at 4°C.

    See Abreview

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-PMPCA/INPP5E antibody (ab140171)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-PMPCA/INPP5E antibody (ab140171)

    Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human fetal colon tissue labelling PMPCA/INPP5E with ab140171 at 1/100 dilution.

  • Western blot - Anti-PMPCA/INPP5E antibody (ab140171)
    Western blot - Anti-PMPCA/INPP5E antibody (ab140171)
    All lanes : Anti-PMPCA/INPP5E antibody (ab140171) at 1/1000 dilution

    Lane 1 : MCF7 cell lysate
    Lane 2 : A549 cell lysate

    Predicted band size: 58 kDa

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Alternative products to Anti-PMPCA/INPP5E antibody (ab140171)

  •  
  • Product image

    Anti-PMPCA/INPP5E antibody (ab221117)

    Applications: ICC/IF, WB

  •  
  • Product image

    Anti-PMPCA/INPP5E antibody (ab241368)

    Applications: IP, WB

  •  
  • Product image

    Anti-PMPCA/INPP5E antibody (ab241292)

    Applications: IP

Clear all

Recently viewed products

  •  
  • Product image

    Anti-MASP1 antibody (ab232945)

  •  
  • Product image

    Anti-EXOSC3 antibody (ab156683)

  •  
  • Product image

    Anti-XPD antibody (ab47186)

  •  
  • Product image

    Anti-ACTN3 antibody (ab211127)

  •  
  • Product image

    Anti-Loricrin antibody (ab168310)

  •  
  • Product image

    Recombinant Human FRS2 protein (ab132038)

Get resources and offers direct to your inbox Sign up
© 2021 Astana Biomed Group LLP. All rights reserved.