Anti-PMPCA/INPP5E antibody (ab140171)
Key features and details
- Rabbit polyclonal to PMPCA/INPP5E
- Suitable for: WB, IHC-P
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-PMPCA/INPP5E antibody
See all PMPCA/INPP5E primary antibodies -
Description
Rabbit polyclonal to PMPCA/INPP5E -
Host species
Rabbit -
Tested applications
Suitable for: WB, IHC-Pmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Mouse, Rat, Dog -
Immunogen
Recombinant fragment corresponding to Human PMPCA/INPP5E aa 186-370.
Sequence:MAVQFELEDLNLRPDPEPLLTEMIHEAAYRENTVGLHRFCPTENVAKINR EVLHSYLRNYYTPDRMVLAGVGVEHEHLVDCARKYLLGVQPAWGSAEAVD IDRSVAQYTGGIAKLERDMSNVSLGPTPIPELTHIMVGLESCSFLEEDFI PFAVLNMMMGGGGSFSAGGPGKGMFSRLYLNVLNR
-
Positive control
- MCF7 and A549 cell lysates; Human fetal colon tissue.
-
General notes
This product was previously labelled as PMPCA
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Lyophilized:Reconstitute with 200ul distilled sterile water. Please note that if you receive this product in liquid form it has already been reconstituted as described and no further reconstitution is necessary. -
Storage instructions
Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 1% BSA, 98% PBS -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Images
-
All lanes : Anti-PMPCA/INPP5E antibody (ab140171) at 1/1000 dilution
Lane 1 : Mouse whole brain homogenate
Lane 2 : Mice brain non-synaptosomal mitochondria
Lane 3 : Mitochondria from ST-Hdh-Q7/Q7 striatal cells
Lane 4 : Mitochondria from ST-Hdh-Q111/Q111 striatal cells
Lane 5 : HEK293 whole cell homogenate
Lane 6 : Mitochondria from HEK293 cells
Lysates/proteins at 20 µg per lane.
Secondary
All lanes : IRDye 800CY-conjugated monoclonal goat anti-rabbit IgG at 1/15000 dilution
Performed under reducing conditions.
Predicted band size: 58 kDa
Observed band size: 50 kDa why is the actual band size different from the predicted?
Additional bands at: 40 kDa (possible non-specific binding)
Exposure time: 5 minutesProtein standard (bands from the top to the bottom: 250, 150, 100, 75 (yellow), 50, 37, 25 (yellow), 20, 15 kDa.
Blocked for 1 hour at 25°C. Incubated with the primary antibody for 16 hours at 4°C.
-
Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human fetal colon tissue labelling PMPCA/INPP5E with ab140171 at 1/100 dilution.
-
All lanes : Anti-PMPCA/INPP5E antibody (ab140171) at 1/1000 dilution
Lane 1 : MCF7 cell lysate
Lane 2 : A549 cell lysate
Predicted band size: 58 kDa