Anti-PHF24 antibody (ab121643)
Key features and details
- Rabbit polyclonal to PHF24
- Suitable for: IHC-P
- Reacts with: Mouse, Human
- Isotype: IgG
Overview
-
Product name
Anti-PHF24 antibody -
Description
Rabbit polyclonal to PHF24 -
Host species
Rabbit -
Tested Applications & Species
See all applications and species dataApplication Species IHC-P Human -
Immunogen
Recombinant fragment corresponding to Human PHF24 aa 194-281.
Sequence:LLTEEEMYSLTETFQRCKVIPDCSLTLEDFLRYRHQAAKRGDRDRALSEE QEEQAARQFAALDPEHRGHIEWPDFLSHESLLLLQQLR
-
Positive control
- IHC-P: Human cerebral cortex and testis tissues.
-
General notes
This product was previously labelled as KIAA1045
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 59% PBS, 40% Glycerol (glycerin, glycerine) -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human cerebral cortex tissue labelling PHF24 with ab121643 at 1/200 dilution. Heat mediated antigen retrieval performed with citrate buffer pH 6 before commencing with IHC staining protocol.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human testis tissue labelling PHF24 with ab121643 at 1/200 dilution. Heat mediated antigen retrieval performed with citrate buffer pH 6 before commencing with IHC staining protocol.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human kidney tissue labelling PHF24 with ab121643 at 1/200 dilution. Heat mediated antigen retrieval performed with citrate buffer pH 6 before commencing with IHC staining protocol.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human skeletal muscle tissue labelling PHF24 with ab121643 at 1/200 dilution. Heat mediated antigen retrieval performed with citrate buffer pH 6 before commencing with IHC staining protocol.