Anti-NMDAR2B antibody [N59/36] (ab93610)
Key features and details
- Mouse monoclonal [N59/36] to NMDAR2B
- Suitable for: Flow Cyt, WB
- Reacts with: Rat, Human
- Isotype: IgG2b
Overview
-
Product name
Anti-NMDAR2B antibody [N59/36]
See all NMDAR2B primary antibodies -
Description
Mouse monoclonal [N59/36] to NMDAR2B -
Host species
Mouse -
Specificity
No cross-reactivity with NMDAR2A. -
Tested Applications & Species
See all applications and species dataApplication Species Flow Cyt HumanWB RatHuman -
Immunogen
Fusion protein corresponding to Rat NMDAR2B aa 20-271 (N terminal).
Sequence:AVSGSKARSQKSPPSIGIAVILVGTSDEVAIKDAHEKDDFHHLSVVPRVE LVAMNETDPKSIITRICDLMSDRKIQGVVFADDTDQEAIAQILDFISAQT LTPILGIHGGSSMIMADKDESSMFFQFGPSIEQQASVMLNIMEEYDWYIF SIVTTYFPGYQDFVNKIRSTIENSFVGWELEEVLLLDMSLDDGDSKIQNQ LKKLQSPIILLYCTKEEATYIFEVANSVGLTGYGYTWIVPSLVAGDTDTV PS
Database link: Q00960 -
Positive control
- Flow Cyt: SH-SY5Y cells.
-
General notes
The clone number has been updated from S59-36 to N59/36, both clone numbers name the same antibody clone.
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing the problem with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation.
One factor contributing to the crisis is the use of antibodies that are not suitable. This can lead to misleading results and the use of incorrect data informing project assumptions and direction. To help address this challenge, we have introduced an application and species grid on our primary antibody datasheets to make it easy to simplify identification of the right antibody for your needs.
Learn more here.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. -
Storage buffer
Preservative: 0.09% Sodium azide
Constituents: 50% Glycerol, PBS -
Concentration information loading... -
Purity
Protein G purified -
Clonality
Monoclonal -
Clone number
N59/36 -
Isotype
IgG2b -
Research areas
Images
-
All lanes : Anti-NMDAR2B antibody [N59/36] (ab93610) at 1/250 dilution
Lane 1 : Induced HEK-T lysates
Lane 2 : Non-Induced HEK-T lysates
Lane 3 : P23X HEK-T negative control lysates
Predicted band size: 166 kDa
-
Overlay histogram showing SH-SY5Y cells stained with ab93610 (red line). The cells were fixed with 4% paraformaldehyde (10 min) and incubated in 1x PBS / 10% normal goat serum / 0.3M glycine to block non-specific protein-protein interactions. The cells were then incubated with the antibody (ab93610, 2µg/1x106 cells) for 30 min at 22ºC. The secondary antibody used was DyLight® 488 goat anti-mouse IgG (H+L) (ab96879) at 1/500 dilution for 30 min at 22ºC. Isotype control antibody (black line) was mouse IgG2b [PLPV219] (ab91366, 2µg/1x106 cells) used under the same conditions. Acquisition of >5,000 events was performed. This antibody gave a positive result in 80% methanol (5 min) fixed SH-SY5Y cells used under the same conditions.
Please note that Abcam do not have any data for use of this antibody on non-fixed cells. We welcome any customer feedback
-
Anti-NMDAR2B antibody [N59/36] (ab93610) at 1/1000 dilution + Rat brain membrane lysate at 15 µg with 1.5% BSA for 30 minutes at RT
Secondary
Sheep Anti-Mouse IgG: HRP for 1 hour at RT
Predicted band size: 166 kDa

