Anti-MAPRE1/EB1 antibody (ab86598)
Key features and details
- Rabbit polyclonal to MAPRE1/EB1
- Suitable for: WB, IP
- Reacts with: Mouse, Human
- Isotype: IgG
Overview
-
Product name
Anti-MAPRE1/EB1 antibody
See all MAPRE1/EB1 primary antibodies -
Description
Rabbit polyclonal to MAPRE1/EB1 -
Host species
Rabbit -
Tested Applications & Species
See all applications and species dataApplication Species IP HumanWB Human -
Immunogen
Synthetic peptide corresponding to Human MAPRE1/EB1 aa 200-245.
Sequence:VNVLKLTVEDLEKERDFYFGKLRNIELICQENEGENDPVLQRIVDI
Database link: NP_036457.1 -
Positive control
- Whole cell lysate from HeLa cells, 293T cells and NIH3T3 cells.
-
General notes
This product was previously labelled as MAPRE1
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. -
Storage buffer
pH: 6.8
Preservative: 0.09% Sodium azide
Constituents: 0.1% BSA, Tris buffered saline -
Concentration information loading... -
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Images
-
All lanes : Anti-MAPRE1/EB1 antibody (ab86598) at 0.04 µg/ml
Lane 1 : Whole cell lysate from HeLa cells at 50 µg
Lane 2 : Whole cell lysate from HeLa cells at 15 µg
Lane 3 : Whole cell lysate from HeLa cells at 5 µg
Lane 4 : Whole cell lysate from 293T cells at 50 µg
Lane 5 : Whole cell lysate from NIH3T3 cells at 50 µg
Predicted band size: 30 kDa
Observed band size: 36 kDa why is the actual band size different from the predicted?
Exposure time: 10 seconds
-
Immunoprecipitation/ Western Blot of ab86598
Lane 1: ab86598 at 10µg/mg whole cell lysate. Lane 2: Control IgG.
ab86598 at 1µg/ml for WB. Whole cell lysate from Hela cells at 1mg for IP, 20% of IP loaded.
Chemiluminescence with an exposure time of 3 seconds.

