Call: +7 771 977 66 65, +7 705 421 2277
Sign in or Register
My basket

Astana Biomed Group, an authorized Abcam distributor in Central Asia

Abiomed homepage

  • Categories
    Signal Transduction
    Cancer
    Epigenetics and Nuclear Signaling
    Immunology
    Cell Biology
    Cardiovascular
    Neuroscience
    Tags & Cell Markers
    Kits/ Lysates/ Other
    Developmental Biology
    Microbiology
    Biochemicals
    Secondary antibodies
    Isotype/Loading Controls
    Antibody Arrays
  • About us
  • Partners
  • Contact
    Address

    Saryarka 32, 18, 010000, Astana city, Kazakhstan

    Telephone +7 771 977 66 65, +7 705 421 2277

    Email

    laboratory@ctlab.kz, orders@abiomed.kz

Back to category
Signal Transduction Protein Trafficking Chaperones Heat Shock Proteins

Anti-Hsp70 antibody [C92F3A-5] (ab47455)

Price and availability

321 638 ₸

Availability

Order now and get it on Tuesday March 02, 2021

Anti-Hsp70 antibody [C92F3A-5] (ab47455)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)

Key features and details

  • Mouse monoclonal [C92F3A-5] to Hsp70
  • Suitable for: WB, Flow Cyt, IHC-P
  • Reacts with: Mouse, Rat, Human
  • Isotype: IgG1

You may also be interested in

Product image
Anti-FKBP52 antibody [EPR21125] - BSA and Azide free (ab237784)
Product image
Anti-TID1 antibody (ab137419)
Product image
Human HSP90AA1 (Hsp90 alpha) knockout HEK-293T cell line (ab266591)
Product image
Anti-Hsp70 antibody [EPR16892] - BSA and Azide free (ab219597)

Overview

  • Product name

    Anti-Hsp70 antibody [C92F3A-5]
    See all Hsp70 primary antibodies
  • Description

    Mouse monoclonal [C92F3A-5] to Hsp70
  • Host species

    Mouse
  • Specificity

    Detects a 70kDa protein corresponding to the molecular mass of Hsp70 of SDS PAGE immunoblots. There is no cross-reactivity to Hsc70 (Hsp73).
  • Tested Applications & Species

    Application Species
    IHC-P
    Human
    WB
    Mouse
    Human
    See all applications and species data
  • Immunogen

    Recombinant fragment corresponding to Human Hsp70 aa 436-503.
    Sequence:

    YSDNQPGVLIQVYEGERAMTKDNNLLGRFELSGIPPAPRGVPQIEVTFDI DANGILNVTATDKSTGKANKITI


    Database link: P08107
    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
  • Epitope

    The mapped epitope is in the region of amino acid residues 436-503.
  • Positive control

    • WB: HeLa, A431, A549, HCT116, HEK293, HepG2, HL-60, HUVEC, Jurkat, MCF7, PC3, T98G cell lysates; Rat Brain tumour lysate; Rat bone lysate. IHC-P: Mouse colon cancer tissue; human colon cancer tissue. Flow cyt: Heat Shocked CD3+ CD8+ T cells

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.1% Sodium azide
    Constituents: PBS, 50% Glycerol (glycerin, glycerine)
  • Concentration information loading...
  • Purity

    Protein G purified
  • Clonality

    Monoclonal
  • Clone number

    C92F3A-5
  • Isotype

    IgG1
  • Research areas

    • Signal Transduction
    • Protein Trafficking
    • Chaperones
    • Heat Shock Proteins
    • Cancer
    • Tumor biomarkers
    • Other

Images

  • Western blot - Anti-Hsp70 antibody [C92F3A-5] (ab47455)
    Western blot - Anti-Hsp70 antibody [C92F3A-5] (ab47455)
    All lanes : Anti-Hsp70 antibody [C92F3A-5] (ab47455) at 1 µg/ml

    Lane 1 : Cell lysate prepared from human A431 cell line
    Lane 2 : Cell lysate prepared from human A549 cell line
    Lane 3 : Cell lysate prepared from human HCT116 cells line
    Lane 4 : Cell lysate prepared from human Hela cell line
    Lane 5 : Cell lysate prepared from human HEK293 cell line
    Lane 6 : Cell lysate prepared from human HepG2 cell line
    Lane 7 : Cell lysate prepared from human HL-60 cell line
    Lane 8 : Cell lysate prepared from human HUVEC cell line
    Lane 9 : Cell lysate prepared from human Jurkat cell line
    Lane 10 : Cell lysate prepared from human MCF7 cell line
    Lane 11 : Cell lysate prepared from human PC3 cell line
    Lane 12 : Cell lysate prepared from human T98G cell line
    Lane 13 : Rat brain tissue lysates

    Predicted band size: 70 kDa



    All are cancer cell lines.

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Hsp70 antibody [C92F3A-5] (ab47455)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Hsp70 antibody [C92F3A-5] (ab47455)

    Formalin-fixed, paraffin-embedded human colon carcinoma tissue stained for Hsp70 using ab47455 at 1/1000 dilution in immunohistochemical analysis. Counter stained with hematoxylin.

  • Western blot - Anti-Hsp70 antibody [C92F3A-5] (ab47455)
    Western blot - Anti-Hsp70 antibody [C92F3A-5] (ab47455) Image courtesy of an anonymous AbReview
    All lanes : Anti-Hsp70 antibody [C92F3A-5] (ab47455) at 1/500 dilution

    All lanes : Rat bone (tibia) whole cell lysate

    Lysates/proteins at 50 µg per lane.

    Predicted band size: 70 kDa

    See Abreview

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Hsp70 antibody [C92F3A-5] (ab47455)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Hsp70 antibody [C92F3A-5] (ab47455)

    ab47455 staining Hsp70 in mouse colon cancer tissue section by Immunohistochemistry (Bouin's fixed paraffin embedded tissue sections). The primary antibody was diluted at 1/100,000. A Fluorophore conjugated goat anti mouse was used as secondary.  An antibody amplifier™ system was used for staining.

  • Flow Cytometry - Anti-Hsp70 antibody [C92F3A-5] (ab47455)
    Flow Cytometry - Anti-Hsp70 antibody [C92F3A-5] (ab47455)

    FACS analysis using ab47455 staining heat shock treated CD3 + CD8 + T cells.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Alternative products to Anti-Hsp70 antibody [C92F3A-5] (ab47455)

  •  
  • Product image

    Anti-Hsp70 antibody [EPR16893] (ab194360)

    Applications: Flow Cyt, ICC/IF, IHC-P, WB

  •  
  • Product image

    Alexa Fluor® 488 Anti-Hsp70 antibody [EP1007Y] (ab197870)

    Applications: Flow Cyt, ICC/IF

  •  
  • Product image

    Anti-Hsp70 antibody [EP1007Y] (ab45133)

    Applications: Flow Cyt, ICC/IF, IHC-P, WB

  •  
  • Product image

    Alexa Fluor® 488 Anti-Hsp70 antibody [EPR16892] (ab204690)

    Applications: ICC/IF

  •  
  • Product image

    Anti-Hsp70 antibody [EPR17677] (ab182844)

    Applications: Flow Cyt, ICC/IF, IHC-P, IP, WB

  •  
  • Product image

    Anti-Hsp70 antibody [EPR16893] - BSA and Azide free (ab238947)

    Applications: Flow Cyt, ICC/IF, IHC-P, WB

  •  
  • Product image

    Anti-Hsp70 antibody [EPR16892] (ab181606)

    Applications: Flow Cyt, ICC/IF, IHC-P, WB

Clear all

Recently viewed products

  •  
  • Product image

    Anti-PGRMC1 antibody - C-terminal (ab194879)

  •  
  • Product image

    Anti-HNRNPUL2 antibody (ab220849)

  •  
  • Product image

    Anti-FAIM2/LFG antibody (ab64187)

Get resources and offers direct to your inbox Sign up
© 2021 Astana Biomed Group LLP. All rights reserved.