Anti-Hsp70 antibody [C92F3A-5] (ab47455)
Key features and details
- Mouse monoclonal [C92F3A-5] to Hsp70
- Suitable for: WB, Flow Cyt, IHC-P
- Reacts with: Mouse, Rat, Human
- Isotype: IgG1
Overview
-
Product name
Anti-Hsp70 antibody [C92F3A-5]
See all Hsp70 primary antibodies -
Description
Mouse monoclonal [C92F3A-5] to Hsp70 -
Host species
Mouse -
Specificity
Detects a 70kDa protein corresponding to the molecular mass of Hsp70 of SDS PAGE immunoblots. There is no cross-reactivity to Hsc70 (Hsp73). -
Tested Applications & Species
See all applications and species dataApplication Species IHC-P HumanWB MouseHuman -
Immunogen
Recombinant fragment corresponding to Human Hsp70 aa 436-503.
Sequence:YSDNQPGVLIQVYEGERAMTKDNNLLGRFELSGIPPAPRGVPQIEVTFDI DANGILNVTATDKSTGKANKITI
Database link: P08107 -
Epitope
The mapped epitope is in the region of amino acid residues 436-503. -
Positive control
- WB: HeLa, A431, A549, HCT116, HEK293, HepG2, HL-60, HUVEC, Jurkat, MCF7, PC3, T98G cell lysates; Rat Brain tumour lysate; Rat bone lysate. IHC-P: Mouse colon cancer tissue; human colon cancer tissue. Flow cyt: Heat Shocked CD3+ CD8+ T cells
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C. Avoid freeze / thaw cycle. -
Storage buffer
Preservative: 0.1% Sodium azide
Constituents: PBS, 50% Glycerol (glycerin, glycerine) -
Concentration information loading...
-
Purity
Protein G purified -
Clonality
Monoclonal -
Clone number
C92F3A-5 -
Isotype
IgG1 -
Research areas
Images
-
All lanes : Anti-Hsp70 antibody [C92F3A-5] (ab47455) at 1 µg/ml
Lane 1 : Cell lysate prepared from human A431 cell line
Lane 2 : Cell lysate prepared from human A549 cell line
Lane 3 : Cell lysate prepared from human HCT116 cells line
Lane 4 : Cell lysate prepared from human Hela cell line
Lane 5 : Cell lysate prepared from human HEK293 cell line
Lane 6 : Cell lysate prepared from human HepG2 cell line
Lane 7 : Cell lysate prepared from human HL-60 cell line
Lane 8 : Cell lysate prepared from human HUVEC cell line
Lane 9 : Cell lysate prepared from human Jurkat cell line
Lane 10 : Cell lysate prepared from human MCF7 cell line
Lane 11 : Cell lysate prepared from human PC3 cell line
Lane 12 : Cell lysate prepared from human T98G cell line
Lane 13 : Rat brain tissue lysates
Predicted band size: 70 kDaAll are cancer cell lines.
-
Formalin-fixed, paraffin-embedded human colon carcinoma tissue stained for Hsp70 using ab47455 at 1/1000 dilution in immunohistochemical analysis. Counter stained with hematoxylin.
-
All lanes : Anti-Hsp70 antibody [C92F3A-5] (ab47455) at 1/500 dilution
All lanes : Rat bone (tibia) whole cell lysate
Lysates/proteins at 50 µg per lane.
Predicted band size: 70 kDa
-
ab47455 staining Hsp70 in mouse colon cancer tissue section by Immunohistochemistry (Bouin's fixed paraffin embedded tissue sections). The primary antibody was diluted at 1/100,000. A Fluorophore conjugated goat anti mouse was used as secondary. An antibody amplifier™ system was used for staining.
-
FACS analysis using ab47455 staining heat shock treated CD3 + CD8 + T cells.