Anti-ODR4/TTG1 antibody (ab121495)
Key features and details
- Rabbit polyclonal to ODR4/TTG1
- Suitable for: ICC/IF, IHC-P, WB
- Reacts with: Mouse, Human
- Isotype: IgG
Overview
-
Product name
Anti-ODR4/TTG1 antibody -
Description
Rabbit polyclonal to ODR4/TTG1 -
Host species
Rabbit -
Tested applications
Suitable for: ICC/IF, IHC-P, WBmore details -
Species reactivity
Reacts with: Mouse, Human -
Immunogen
Recombinant fragment corresponding to Human ODR4/TTG1 aa 339-421.
Sequence:FHVLPYRVFVPLPGSTVMLCDYKFDDESAEEIRDHFMEMLDHTIQIEDLE IAEETNTACMSSSMNSQASLDNTDDEQPKQPIK
-
Positive control
- Human pancreas tissue; RT-4 and U-251 MG cell lysates; Human Liver lysate
-
General notes
This product was previously labelled as ODR4
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 59% PBS, 40% Glycerol (glycerin, glycerine) -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Images
-
All lanes : Anti-ODR4/TTG1 antibody (ab121495) at 1/250 dilution
Lane 1 : RT-4 cell lysate
Lane 2 : U-251 MG cell lysate
Lane 3 : Human Plasma lysate
Lane 4 : Human Liver lysate
Lane 5 : Human Tonsil lysate
Predicted band size: 51 kDaDeveloped using the ECL technique
-
Immunofluorescent staining of Human cell line A-431 shows positivity in plasma membrane. Recommended concentration of ab121495 1-4 µg/ml. Cells treated with PFA/Triton X-100.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-ODR4/TTG1 antibody (ab121495)
ab121495 staining ODR4/TTG1 in paraffin-embedded Human pancreas tissue by Immunohistochemistry.
-
Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)
Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)