Anti-HIF-2-alpha antibody [OTI2G5] (ab157249)
Key features and details
- Mouse monoclonal [OTI2G5] to HIF-2-alpha
- Suitable for: WB
- Reacts with: Human
- Isotype: IgG1
Overview
-
Product name
Anti-HIF-2-alpha antibody [OTI2G5]
See all HIF-2-alpha primary antibodies -
Description
Mouse monoclonal [OTI2G5] to HIF-2-alpha -
Host species
Mouse -
Tested applications
Suitable for: WBmore details -
Species reactivity
Reacts with: Human -
Immunogen
Recombinant fragment corresponding to Human HIF-2-alpha aa 584-870.
Sequence:LLDKFQQQLESKKTEPEHRPMSSIFFDAGSKASLPPCCGQASTPLSSMGG RSNTQWPPDPPLHFGPTKWAVGDQRTEFLGAAPLGPPVSPPHVSTFKTRS AKGFGARGPDVLSPAMVALSNKLKLKRQLEYEEQAFQDLSGGDPPGGSTS HLMWKRMKNLRGGSCPLMPDKPLSANVPNDKFTQNPMRGLGHPLRHLPLP QPPSAISPGENSKSRFPPQCYATQYQDYSLSSAHKVSGMASRLLGPSFES YLLPELTRYDCEVNVPVLGSSTLLQGGDLLRALDQAT
-
Positive control
- HEK293T cells transfected with pCMV6-ENTRY HIF-2-alpha.
-
General notes
The clone number has been updated from 2G5 to OTI2G5, both clone numbers name the same clone.
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. -
Storage buffer
pH: 7.30
Preservative: 0.02% Sodium azide
Constituents: 48% PBS, 50% Glycerol, 1% BSA -
Concentration information loading...
-
Purity
Protein G purified -
Purification notes
Purified from TCS -
Clonality
Monoclonal -
Clone number
OTI2G5 -
Isotype
IgG1 -
Research areas
Images
-
All lanes : Anti-HIF-2-alpha antibody [OTI2G5] (ab157249) at 1/2000 dilution
Lane 1 : HEK293T cells transfected with pCMV6-ENTRY control
Lane 2 : HEK293T cells transfected with pCMV6-ENTRY HIF2 alpha
Lysates/proteins at 5 µg per lane.
Predicted band size: 96 kDa
HEK293T cell lysates were generated from transient transfection of the cDNA clone (RC216194)