Astana Biomed Group, an authorized Abcam distributor in Central Asia

Anti-Heme Oxygenase 1 antibody [HO-1-1] (ab13248)

Key features and details

  • Mouse monoclonal [HO-1-1] to Heme Oxygenase 1
  • Suitable for: WB, Flow Cyt, Sandwich ELISA, IHC-P
  • Reacts with: Mouse, Rat, Cow, Dog, Human
  • Isotype: IgG1

Overview

  • Product name

    Anti-Heme Oxygenase 1 antibody [HO-1-1]
    See all Heme Oxygenase 1 primary antibodies

  • Description

    Mouse monoclonal [HO-1-1] to Heme Oxygenase 1

  • Host species

    Mouse

  • Tested Applications & Species

    Application Species
    Flow Cyt
    Human
    IHC-P
    Human
    sELISA
    Mouse
    WB
    Rat
    Cow
    Human
    See all applications and species data

  • Immunogen

    Synthetic peptide:

    MERPQPDSMPQDLSEALKEATKEVHTQAEN

    , corresponding to amino acids 1-30 of Human Heme Oxygenase 1.
    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI

  • Positive control

    • Recombinant Human or Rat HO-1 (Hsp32) Protein. HEK293 treated with 30 uM hemin for 18hrs (see Abreview). IHC-P: FFPE human spleen normal.

  • General notes

    This product was changed from ascites to tissue culture supernatant on 22nd May 2019. Please note that the dilutions may need to be adjusted accordingly. If you have any questions, please do not hesitate to contact our scientific support team.

Properties

Images

  • Western blot - Anti-Heme Oxygenase 1 antibody [HO-1-1] (ab13248)
    Western blot - Anti-Heme Oxygenase 1 antibody [HO-1-1] (ab13248)
    All lanes : Anti-Heme Oxygenase 1 antibody [HO-1-1] (ab13248) at 1 µg/ml

    Lane 1 : Hek293
    Lane 2 : HL60
    Lane 3 : HeLa
    Lane 4 : A549
    Lane 5 : Hu spleen
    Lane 6 : Ms spleen
    Lane 7 : Rt spleen

    Lysates/proteins at 10 µg per lane.

    Secondary
    All lanes : IRDye® 800CW Goat anti Mouse

    Predicted band size: 34.6 kDa
    Observed band size: 32 kDa
    why is the actual band size different from the predicted?



    Hek293 & HL60 presumed negative or very low expression.

    Loading control GAPDH at 38kDa

    This image was generated using the ascites version of the product.

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Heme Oxygenase 1 antibody [HO-1-1] (ab13248)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Heme Oxygenase 1 antibody [HO-1-1] (ab13248)

    IHC image of Hem Oxygensae 1 staining in a section of formalin fixed, paraffin embedded normal human spleen tissue section*, performed on a Leica Bond™ system using the standard protocol F. The section was pre-treated using heat mediated antigen retrieval with sodium citrate buffer (pH6, epitope retrieval solution 1) for 20 mins. The section was then incubated with ab13248, 5µg/ml, for 15 mins at room temperature and detected using an HRP conjugated compact polymer system. DAB was used as the chromogen. The section was then counterstained with haematoxylin and mounted with DPX.

    This image was generated using the ascites version of the product.

     

    For other IHC staining systems (automated and non-automated) customers should optimize variable parameters such as antigen retrieval conditions, primary antibody concentration and antibody incubation times.

    *Tissue obtained from the Human Research Tissue Bank, supported by the NIHR Cambridge Biomedical Research Centre

  • Western blot - Anti-Heme Oxygenase 1 antibody [HO-1-1] (ab13248)
    Western blot - Anti-Heme Oxygenase 1 antibody [HO-1-1] (ab13248)

    The following proteins and lysates were electrophoresed; Lane 1 - Heme-Oxygenase-1 (Hsp32) Protein (50ng), lane 2 - Heme-Oxygenase-2 protein NSP-550 (100ng), lane 3 - MDBK Cell Lysate (20ug), lane 4 - Mouse liver microsome (20ug) and lane 5 - Dog liver microsome (20ug). ab13248 was applied at a concentration of 4ugml-1.

    This image was generated using the ascites version of the product.

  • Sandwich ELISA - Anti-Heme Oxygenase 1 antibody [HO-1-1] (ab13248)
    Sandwich ELISA - Anti-Heme Oxygenase 1 antibody [HO-1-1] (ab13248)

    Standard Curve for Heme Oxygenase 1 (Analyte: Heme Oxygenase 1 protein (Tagged) (ab85243)); dilution range 1pg/ml to 1µg/ml using Capture Antibody Mouse monoclonal [HO-1-1] to Heme Oxygenase 1 (ab13248) at 5µg/ml and Detector Antibody Rabbit polyclonal to Heme Oxygenase 1 (ab13243) at 0.5µg/ml.

    This image was generated using the ascites version of the product.

  • Western blot - Anti-Heme Oxygenase 1 antibody [HO-1-1] (ab13248)
    Western blot - Anti-Heme Oxygenase 1 antibody [HO-1-1] (ab13248)
    Lane 1 : MW marker
    Lanes 2-7 : Anti-Heme Oxygenase 1 antibody [HO-1-1] (ab13248)

    Lane 2 : Recombinant Rat Heme Oxygenase 1
    Lane 3 : Recombinant Human Heme Oxygenase 1
    Lane 4 : Recombinant Human Heme Oxygenase 2
    Lane 5 : MDBK cell lysate
    Lane 6 : Dog liver microsome
    Lane 7 : Mouse liver microsome

    Predicted band size: 34.6 kDa



    This image was generated using the ascites version of the product.

  • Western blot - Anti-Heme Oxygenase 1 antibody [HO-1-1] (ab13248)
    Western blot - Anti-Heme Oxygenase 1 antibody [HO-1-1] (ab13248)
    Anti-Heme Oxygenase 1 antibody [HO-1-1] (ab13248) at 1/250 dilution + Human microsome lysate

    Predicted band size: 34.6 kDa



    This image was generated using the ascites version of the product.

  • Flow Cytometry - Anti-Heme Oxygenase 1 antibody [HO-1-1] (ab13248)
    Flow Cytometry - Anti-Heme Oxygenase 1 antibody [HO-1-1] (ab13248)

    ab13248 at 10µg/ml staining Heme Oxygenase 1 in human lung cancer A2 cells by flow cytometery. The left image repersents staining with isotype control antibody and the right image show staining with ab13248.

    This image was generated using the ascites version of the product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Alternative products to Anti-Heme Oxygenase 1 antibody [HO-1-1] (ab13248)

© 2021 Astana Biomed Group LLP. All rights reserved.